y PlantCAZyme

CAZyme Information

Basic Information
SpeciesBrachypodium distachyon
Cazyme IDBradi3g40907.1
FamilyCBM43
Protein PropertiesLength: 591 Molecular Weight: 62210.8 Isoelectric Point: 8.9872
ChromosomeChromosome/Scaffold: 3 Start: 42991035 End: 42993176
DescriptionO-Glycosyl hydrolases family 17 protein
View CDS
External Links
NCBI Taxonomy
Plaza
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
CBM433974801.8e-32
  WCVLLPGKDEKAVAAALNYACGQGSGTCAAIQPGAVCFEPNTLDAHASYAFNSYWQQFRKSGASCSFNGLATTTTTDPSHGSCK
CBM435015841.4e-33
  WCVLAPGKDEKAVEAALNYACGQGQGTCAAIQPGGACFEPNTLDAHASYAFNSYWQQFRKTGGSCSFNGLAVTTTADPSHGSCK
GH17443640
  LGVNYGTLGDNLPTPTRSVRLLRDAGAGAVKIYDANPEILSAFAGTGIPVSAMVPNEIIPSIAASRAAAHKWVVNNLPKPSSHGPKIVYLLVGNELLSNQ
  AIKDSTWGAIVPAMRNLRHALRKHGMGRVKLGTPLAMDALSASYPPSSSLFRDDIELKVMRPLLRFLNLTKSYYFVDAYPYFAWAGNQDTISLDYALFQG
  KSGAFHVDPQTGLKYTNLLDQMLDACVAAMAKLGFGKIKMAIAETGWPNGGGPGASVGNAAIYNRNLAARMATSPGTPLRPGEKMPVFVFSLYNEDKKPG
  AGTERHWGLFYPNGTAVYQVD
Full Sequence
Protein Sequence     Length: 591     Download
MASSYSLLAA VLFLLAAAFS CHCNVAAAKK GHGQKGHGKR AHGLGVNYGT LGDNLPTPTR    60
SVRLLRDAGA GAVKIYDANP EILSAFAGTG IPVSAMVPNE IIPSIAASRA AAHKWVVNNL    120
PKPSSHGPKI VYLLVGNELL SNQAIKDSTW GAIVPAMRNL RHALRKHGMG RVKLGTPLAM    180
DALSASYPPS SSLFRDDIEL KVMRPLLRFL NLTKSYYFVD AYPYFAWAGN QDTISLDYAL    240
FQGKSGAFHV DPQTGLKYTN LLDQMLDACV AAMAKLGFGK IKMAIAETGW PNGGGPGASV    300
GNAAIYNRNL AARMATSPGT PLRPGEKMPV FVFSLYNEDK KPGAGTERHW GLFYPNGTAV    360
YQVDLGGRRR SYPPLPSPPP SPSPSTPPSP PAEQGLWCVL LPGKDEKAVA AALNYACGQG    420
SGTCAAIQPG AVCFEPNTLD AHASYAFNSY WQQFRKSGAS CSFNGLATTT TTDPSHGSCK    480
FPSSPATPPP PPPPPVELGV WCVLAPGKDE KAVEAALNYA CGQGQGTCAA IQPGGACFEP    540
NTLDAHASYA FNSYWQQFRK TGGSCSFNGL AVTTTADPSH GSCKFPSSSN *             600
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
pfam07983X87.0e-2039646878+
pfam07983X83.0e-2050157277+
smart00768X86.0e-3939648186+
smart00768X83.0e-3950158585+
pfam00332Glyco_hydro_172.0e-8744364325+
Gene Ontology
GO TermDescription
GO:0004553hydrolase activity, hydrolyzing O-glycosyl compounds
GO:0005975carbohydrate metabolic process
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
RefSeqNP_001149815.102348816479glucan endo-1,3-beta-glucosidase A6 [Zea mays]
RefSeqXP_002444717.101248426482hypothetical protein SORBIDRAFT_07g026540 [Sorghum bicolor]
RefSeqXP_002444717.12e-28488588379482hypothetical protein SORBIDRAFT_07g026540 [Sorghum bicolor]
RefSeqXP_002462618.104448837483hypothetical protein SORBIDRAFT_02g029080 [Sorghum bicolor]
RefSeqXP_002462618.14e-31483588370479hypothetical protein SORBIDRAFT_02g029080 [Sorghum bicolor]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB1ghs_B0443651306A Chain A, The Three-Dimensional Structures Of Two Plant Beta-Glucan Endohydrolases With Distinct Substrate Specificities
PDB1ghs_A0443651306A Chain A, The Three-Dimensional Structures Of Two Plant Beta-Glucan Endohydrolases With Distinct Substrate Specificities
PDB2cyg_A0443651312A Chain A, Crystal Structure At 1.45- Resolution Of The Major Allergen Endo-Beta-1,3-Glucanase Of Banana As A Molecular Basis For The Latex-Fruit Syndrome
PDB1ghr_A0443651306A Chain A, Crystal Structure At 1.45- Resolution Of The Major Allergen Endo-Beta-1,3-Glucanase Of Banana As A Molecular Basis For The Latex-Fruit Syndrome
PDB1aq0_B0443651306A Chain A, Barley 1,3-1,4-Beta-Glucanase In Monoclinic Space Group
Transmembrane Domains
StartEnd
728
Signal Peptide
Cleavage Site
28
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
EE0439692621143690
EE1582982621143690
EC9045942621143690
EE0457692471293690
DV5091242471293690
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_034_00089.1.396.481Aquca_009_00879.1.376.461
Arabidopsis lyrata317589.371.454479892.387.470493503.389.472
Arabidopsis thalianaAT3G07320.1.371.454AT3G23770.1.387.470AT4G14080.1.389.472
Brachypodium distachyonBradi3g40907.1.397.480Bradi3g40907.1.397.480Bradi4g34390.1.385.471Bradi5g12137.1.382.465Bradi3g40907.1.501.584
Bradi3g40907.1.501.584
Brassica rapaBra001918.391.473Bra028343.387.470Bra037057.390.473Bra014979.389.472Bra001245.371.450
Bra032758.391.474Bra029639.371.454Bra038969.390.468
Carica papayaevm.model.supercontig_8.110.373.456evm.model.supercontig_157.32.380.459
Capsella rubellaCarubv10006945m.389.472Carubv10015952m.387.470Carubv10013655m.371.454
Citrus clementinaCiclev10031440m.377.460Ciclev10004917m.379.458
Citrus sinensisorange1.1g012660m.379.457
Cucumis sativusCucsa.251950.1.378.460Cucsa.149990.1.374.457
Eucalyptus grandisEucgr.K02113.2.377.460Eucgr.K02113.1.377.460Eucgr.H02646.1.352.434
Fragaria vescamrna17437.1-v1.0-hybrid.483.561mrna17436.1-v1.0-hybrid.347.425
Glycine maxGlyma18g32840.1.378.461Glyma08g46110.1.378.461
Gossypium raimondiiGorai.005G026800.1.373.456Gorai.001G230200.2.372.451Gorai.006G224700.1.373.456Gorai.001G230200.3.297.380Gorai.001G230200.1.372.455
Gorai.N004800.1.375.458
Linum usitatissimumLus10008881.379.462Lus10023226.358.441Lus10001740Lus10025892.333.417Lus10038211.374.458
Malus domesticaMDP0000317729.374.452MDP0000283768.334.416MDP0000235663.374.452
Manihot esculentacassava4.1_023781m.375.458cassava4.1_024973m.361.439cassava4.1_007070m.376.459
Medicago truncatulaMedtr8g012400.1.374.457
Mimulus guttatusmgv1a005774m.382.465mgv1a006049m.370.453
Oryza sativaLOC_Os09g32550.2.384.471LOC_Os09g32550.1.387.474LOC_Os03g62860.1.382.467LOC_Os08g41410.1.385.467
Panicum virgatumPavirv00066351m.389.471Pavirv00044843m.360.447Pavirv00008164m.395.481Pavirv00006057m.374.460Pavirv00059046m.386.467
Phaseolus vulgarisPhvul.010G023800.1.372.455Phvul.008G142200.1.376.459
Picea abiesMA_907g0010MA_2025g0010.240.322MA_10426132g0010.130.212MA_10434158g0010.296.378MA_228746g0010.274.356
Populus trichocarpaPotri.002G247900.2.376.454Potri.002G247900.1.376.459Potri.002G247800.1.376.459Potri.017G060300.1.377.460Potri.001G321900.1.327.410
Prunus persicappa006984m.298.381ppa016789m.361.446
Ricinus communis28401.m000073.298.381
Setaria italicaSi029669m.389.476Si015679m.397.484
Selaginella moellendorffii85067.362.443
Sorghum bicolorSb01g001430.1.390.476Sb02g029080.1.388.475Sb07g026540.1.393.478
Thellungiella halophilaThhalv10002513m.385.468Thhalv10025081m.390.473Thhalv10020660m.380.463Thhalv10020663m.380.463
Vitis viniferaGSVIVT01031619001.286.369GSVIVT01031698001.378.461
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)