y PlantCAZyme

CAZyme Information

Basic Information
SpeciesBrachypodium distachyon
Cazyme IDBradi3g42330.1
FamilyGH35
Protein PropertiesLength: 848 Molecular Weight: 95363.8 Isoelectric Point: 8.4799
ChromosomeChromosome/Scaffold: 3 Start: 43999934 End: 44003380
Descriptionglycosyl hydrolase family 35 protein
View CDS
External Links
NCBI Taxonomy
Plaza
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GH35463500
  LMVDGRRDLFFSGSIHYPRSPPHMWPDLIARAKEGGLNVIESYVFWNGHEPEMGVYNFEGRYDMIKFFKLVQEHEMFAMVRIGPFVQAEWNHGGLPYWLR
  EVPDIIFRTNNEPFKKHMQKFVTMIVNKLKDAKLFASQGGPIILAQIENEYQHLEAAFKENGTTYIHWAAKMASDLNIGVPWIMCKQTKAPGEVIPTCNG
  RHCGDTWPGPTDKNKPLLWTENWTAQYRVFGDPPSQRSAEDIAFAVARFYSVGGTMVNYYMYHGGTNFGRTGASFVMPRYYDEAPLDEFGLYKEPKWGHL
  RDLHH
Full Sequence
Protein Sequence     Length: 848     Download
MSLLRLLLFF FFFLAAGGGG NGGIGKCEAY GLTKEGTAIT FDRRSLMVDG RRDLFFSGSI    60
HYPRSPPHMW PDLIARAKEG GLNVIESYVF WNGHEPEMGV YNFEGRYDMI KFFKLVQEHE    120
MFAMVRIGPF VQAEWNHGGL PYWLREVPDI IFRTNNEPFK KHMQKFVTMI VNKLKDAKLF    180
ASQGGPIILA QIENEYQHLE AAFKENGTTY IHWAAKMASD LNIGVPWIMC KQTKAPGEVI    240
PTCNGRHCGD TWPGPTDKNK PLLWTENWTA QYRVFGDPPS QRSAEDIAFA VARFYSVGGT    300
MVNYYMYHGG TNFGRTGASF VMPRYYDEAP LDEFGLYKEP KWGHLRDLHH ALRLCKKAIL    360
WGNPSNQPLG KLYEARLFEI PEQKICVAFL SNHNTKEDGT VTFRGQQYFV PRRSVSILAD    420
CKTVVFSTQH VNSQHNQRTF HFSDQTVQGN VWEMYTESDK VPTYKFTNIR TQKPLEAYNL    480
TKDKTDYVWY TTSFKLEAED LPFRKDIWPV LEVSSHGHAM VAFVNGKYVG AGHGTKINKA    540
FTMEKPIEVR TGINHVSILS TTLGMQDSGV YLEHRQAGID GVTIQGLNTG TLDLTSNGWG    600
HLVGLEGERR NAHTEKGGDG VQWVPAVFDR PLTWYRRRFD IPTGDDPVVI DMSPMGKGVL    660
YVNGEGLGRY WSSYKHALGR PSQYLYHVPR CFLKPTGNVM TIFEEEGGGQ PDGIMILTVK    720
RDNICSFISE KNPAHVKSWE RKDSHLKSVA DADLKPQAVL SCPEKKLIQQ VVFASYGNPL    780
GICGNYTVGN CHAPKAKEIV EKACVGKKSC VLQVSHEVYG ADLNCPGSTG TLAVQAKCSK    840
RQKAADQ*                                                             900
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
pfam02449Glyco_hydro_420.000270196141+
COG1874LacA6.0e-1739206175+
pfam02140Gal_Lectin7.0e-2276083882+
pfam01301Glyco_hydro_351.0e-13745352322+
PLN03059PLN03059038839827+
Gene Ontology
GO TermDescription
GO:0004553hydrolase activity, hydrolyzing O-glycosyl compounds
GO:0004565beta-galactosidase activity
GO:0005529Interacting selectively and non-covalently with any carbohydrate, which includes monosaccharides, oligosaccharides and polysaccharides as well as substances derived from monosaccharides by reduction of the carbonyl group (alditols), by oxidation of one or more hydroxy groups to afford the corresponding aldehydes, ketones, or carboxylic acids, or by replacement of one or more hydroxy group(s) by a hydrogen atom. Cyclitols are generally not regarded as carbohydrates." [CHEBI:16646, GOC:mah]
GO:0005975carbohydrate metabolic process
GO:0009341beta-galactosidase complex
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankACL54349.103384737850unknown [Zea mays]
GenBankEEE69115.103284126839hypothetical protein OsJ_28192 [Oryza sativa Japonica Group]
GenBankEEE70132.103083827830hypothetical protein OsJ_30164 [Oryza sativa Japonica Group]
RefSeqNP_001062440.103284126839Os08g0549200 [Oryza sativa (japonica cultivar-group)]
RefSeqXP_002445734.103384532841hypothetical protein SORBIDRAFT_07g024870 [Sorghum bicolor]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB3d3a_A7e-36353485325A Chain A, Crystal Structure Of A Beta-Galactosidase From Bacteroides Thetaiotaomicron
PDB3d3a_A0.002633723509595A Chain A, Crystal Structure Of A Beta-Galactosidase From Bacteroides Thetaiotaomicron
PDB3thd_D1e-34333485330A Chain A, Crystal Structure Of A Beta-Galactosidase From Bacteroides Thetaiotaomicron
PDB3thd_C1e-34333485330A Chain A, Crystal Structure Of A Beta-Galactosidase From Bacteroides Thetaiotaomicron
Metabolic Pathways
Pathway NameReactionECProtein Name
lactose degradation IIIBETAGALACTOSID-RXNEC-3.2.1.23β-galactosidase
Signal Peptide
Cleavage Site
19
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
HO778160695387080
HO780602591896740
CO128575294693620
HO7955525291296520
HO780602296797074.2
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_014_00260.2Aquca_014_00260.1Aquca_006_00263.3Aquca_006_00263.2Aquca_006_00263.1
Arabidopsis lyrata496568476906491156480556912308
Arabidopsis thalianaAT5G63800.1AT1G77410.1AT4G38590.2AT4G38590.1AT2G16730.1
AT4G35010.1
Brachypodium distachyonBradi2g56597.1Bradi4g36517.1Bradi2g24670.1
Brassica rapaBra029200Bra011577Bra017687Bra013052Bra001991
Bra033571Bra024237
Carica papayaevm.model.supercontig_37.29evm.model.supercontig_64.121evm.model.supercontig_64.120evm.model.supercontig_37.144
Capsella rubellaCarubv10028665mCarubv10022317mCarubv10007813mCarubv10006573mCarubv10016129m
Citrus clementinaCiclev10000420mCiclev10004034mCiclev10003478mCiclev10023501mCiclev10026929m
Ciclev10030124m
Citrus sinensisorange1.1g003612morange1.1g041957morange1.1g045037morange1.1g035496morange1.1g006326m
orange1.1g006301m
Cucumis sativusCucsa.060550.1Cucsa.370570.1
Eucalyptus grandisEucgr.H05090.1Eucgr.G01775.1Eucgr.I02332.1Eucgr.I01412.1
Fragaria vescamrna24180.1-v1.0-hybridmrna11229.1-v1.0-hybridmrna06055.1-v1.0-hybridmrna07651.1-v1.0-hybrid
Glycine maxGlyma06g16430.1Glyma04g38580.3Glyma08g00470.1Glyma04g38580.1Glyma04g38580.2
Glyma08g00470.2Glyma04g42620.3Glyma06g12150.1Glyma04g42620.2Glyma06g12150.2
Glyma12g03650.1Glyma12g03650.2Glyma04g00520.1Glyma11g11500.1
Gossypium raimondiiGorai.012G037700.1Gorai.010G052200.1Gorai.010G052300.1Gorai.009G265200.1Gorai.002G197200.3
Gorai.002G197200.2Gorai.002G197200.1Gorai.002G197100.1Gorai.008G036000.1
Linum usitatissimumLus10020875.306.587Lus10020875.306.587Lus10028538Lus10033502Lus10033427
Lus10018138Lus10008259Lus10033500Lus10020875.38.306Lus10020875.38.306
Lus10014126Lus10019784Lus10005071Lus10027844Lus10027843
Malus domesticaMDP0000202466MDP0000316304MDP0000243780MDP0000206284MDP0000322037
MDP0000320504MDP0000225967MDP0000222132MDP0000863563
Manihot esculentacassava4.1_033913mcassava4.1_025630mcassava4.1_023088mcassava4.1_031197mcassava4.1_023181m
cassava4.1_023219m
Medicago truncatulaMedtr3g096910.1Medtr8g095690.1Medtr3g088520.1Medtr3g117840.1Medtr4g073290.1
Mimulus guttatusmgv1a018569mmgv1a001345m
Oryza sativaLOC_Os05g35360.1LOC_Os08g43570.1LOC_Os09g36810.1
Panicum virgatumPavirv00062685mPavirv00037142mPavirv00063105mPavirv00038064mPavirv00037143m
Pavirv00021342mPavirv00010263mPavirv00038026mPavirv00010484m
Phaseolus vulgarisPhvul.009G153000.1Phvul.009G127500.1Phvul.009G119400.1Phvul.L007600.1Phvul.009G119600.1
Phvul.011G035300.1
Picea abiesMA_65469g0020
Populus trichocarpaPotri.005G069200.2Potri.005G069200.1Potri.005G180600.1Potri.002G080700.1Potri.013G105100.1
Potri.009G134400.1Potri.004G174800.1
Prunus persicappa001308mppa019277mppa026900mppa020492m
Ricinus communis29648.m00200830074.m001370
Setaria italicaSi004751mSi021244mSi024535mSi013260mSi028962m
Sorghum bicolorSb09g021140.1Sb07g024870.1Sb02g031260.1
Thellungiella halophilaThhalv10018129mThhalv10005464mThhalv10024392mThhalv10022550m
Vitis viniferaGSVIVT01022353001GSVIVT01008835001GSVIVT01008834001GSVIVT01024031001
Zea maysAC234152.1_FGT005
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)