y PlantCAZyme

CAZyme Information

Basic Information
SpeciesBrachypodium distachyon
Cazyme IDBradi3g42910.1
FamilyGT41
Protein PropertiesLength: 960 Molecular Weight: 105877 Isoelectric Point: 5.4938
ChromosomeChromosome/Scaffold: 3 Start: 44290897 End: 44297858
DescriptionTetratricopeptide repeat (TPR)-like superfamily protein
View CDS
External Links
NCBI Taxonomy
Plaza
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GT413538710
  TIKPNFSQSLNNLGVVYTVQGKMDAAASMIEKAILANPTYAEAYNNLGVLYRDAGSITLSVQAYERCLQIDPDSRNAGQNRLLAMNYIDEGSDDKLYNAH
  REWGKRFMKMYAQYTSWDNSKVADRPLVIGYVSPDFFTHSVSYFVEAPLAHHDYSNCKVVVYSGVVKADAKTLRFKDKVLKKGGVWRDIYGIDEKRVASM
  VREDKVDILVELTGHTANNKLGTMACRPAPIQVTWIGYPNTTGLPAIDYRITDSLADSPNTNQKHVEELVRLPESFLCYTPSPEAGPVCPTPAISNNFIT
  FGSFNNLAKITPKVLQVWARILCAVPNSRLVVKCKPFGCDSIRQKFLSTLEELGLESIRVDLLPLIHLNHDHMQAYSLMDISLDTFPYAGTTTTCESLYM
  GVPCVTMAGSVHAHNVGVSLLTKVGLGRLVAKSEDEYVSLALDLASDVGALQELRMSLREQMIKSPVCDGEGFTRGLESAYRNMWRRYCDGDSPALSRPE
  LLEDQPVSNKEDLNKMALK
Full Sequence
Protein Sequence     Length: 960     Download
MGQPGMDSLE RKETNGVVPD RNGAAAAAAA PPATQQQEGK DALQYANILR SRNKFADALQ    60
LYSTVLEKDG TNVEALIGKG ICLQAQNLPK QALECFTEAV KVDPNNACAL THCGMIYKDE    120
GHLVEAAEAY QKARSADPSY KPAAEFLAIV LTDLGTKLKL AGNTEEGIQK YCEALEVDTH    180
YAPAYYNLGV VYSEMMQFDV ALTCYEKAAI ERPLYAEAYC NLGVIYKNRG DLDAAIACYE    240
RCLTISPNFE IAKNNMAIAL TDLGTKVKIE GDIKQGVAYY KKALFYNWHY ADAMYNLGVA    300
YGEMLNFEMA IVSYELALHF NPRCAEACNN LGVIYKDRDN LDRAVECYQM ALTIKPNFSQ    360
SLNNLGVVYT VQGKMDAAAS MIEKAILANP TYAEAYNNLG VLYRDAGSIT LSVQAYERCL    420
QIDPDSRNAG QNRLLAMNYI DEGSDDKLYN AHREWGKRFM KMYAQYTSWD NSKVADRPLV    480
IGYVSPDFFT HSVSYFVEAP LAHHDYSNCK VVVYSGVVKA DAKTLRFKDK VLKKGGVWRD    540
IYGIDEKRVA SMVREDKVDI LVELTGHTAN NKLGTMACRP APIQVTWIGY PNTTGLPAID    600
YRITDSLADS PNTNQKHVEE LVRLPESFLC YTPSPEAGPV CPTPAISNNF ITFGSFNNLA    660
KITPKVLQVW ARILCAVPNS RLVVKCKPFG CDSIRQKFLS TLEELGLESI RVDLLPLIHL    720
NHDHMQAYSL MDISLDTFPY AGTTTTCESL YMGVPCVTMA GSVHAHNVGV SLLTKVGLGR    780
LVAKSEDEYV SLALDLASDV GALQELRMSL REQMIKSPVC DGEGFTRGLE SAYRNMWRRY    840
CDGDSPALSR PELLEDQPVS NKEDLNKMAL KLADIKSQRA NTATEEHNQG LIKVNATPEQ    900
DEQPQIIVNG ARSPEDNQPL ATVNTVAQED KQPQVITNGV SSPHSSTSGR CEANGHSSR*    960
                                                                     1020
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
pfam13844Glyco_transf_411.0e-18479628153+
pfam13844Glyco_transf_416.0e-24651837187+
COG3914Spy3.0e-95310840552+
Gene Ontology
GO TermDescription
GO:0005515protein binding
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankEEC84033.1069591947hypothetical protein OsI_30264 [Oryza sativa Indica Group]
GenBankEEE69149.1069591947hypothetical protein OsJ_28275 [Oryza sativa Japonica Group]
RefSeqNP_001062501.1019591927Os08g0559300 [Oryza sativa (japonica cultivar-group)]
Swiss-ProtO82422069591944SPY_HORVU RecName: Full=Probable UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase SPINDLY; AltName: Full=HvSPY
RefSeqXP_002445679.1019571909hypothetical protein SORBIDRAFT_07g024110 [Sorghum bicolor]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB1w3b_B6e-385940023380A Chain A, The Superhelical Tpr Domain Of O-linked Glcnac Transferase Reveals Structural Similarities To Importin Alpha.
PDB1w3b_B1e-2711243221344A Chain A, The Superhelical Tpr Domain Of O-linked Glcnac Transferase Reveals Structural Similarities To Importin Alpha.
PDB1w3b_B1e-2280337142385A Chain A, The Superhelical Tpr Domain Of O-linked Glcnac Transferase Reveals Structural Similarities To Importin Alpha.
PDB1w3b_B1e-1925645366261A Chain A, The Superhelical Tpr Domain Of O-linked Glcnac Transferase Reveals Structural Similarities To Importin Alpha.
PDB1w3b_B0.000000000158263188386A Chain A, The Superhelical Tpr Domain Of O-linked Glcnac Transferase Reveals Structural Similarities To Importin Alpha.
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
GT0417893373366720
GT041789981632600.000000000009
GT0417891252273490.00000007
GT041789681982650.002
GT041789134501811.2
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_058_00216.4.161.321Aquca_058_00216.4.161.321Aquca_058_00216.3.387.547Aquca_058_00216.3.387.547Aquca_058_00216.2
Aquca_058_00216.1.601.761Aquca_058_00216.1.601.761Aquca_072_00077.2Aquca_072_00077.3Aquca_072_00077.1
Arabidopsis lyrata896453.457.745896453.457.745478494
Arabidopsis thalianaAT3G04240.1.457.745AT3G04240.1.457.745AT3G11540.1AT3G11540.2
Brachypodium distachyonBradi3g43577.3.610.769Bradi3g43577.3.610.769Bradi3g43577.2Bradi3g43577.1Bradi5g06647.1.621.781
Bradi5g06647.1.621.781Bradi2g58616.1.592.750Bradi2g58616.1.592.750
Brassica rapaBra040144.586.743Bra040144.586.743Bra001408Bra034832
Carica papayaevm.model.supercontig_51.46.234.522evm.model.supercontig_51.46.234.522
Capsella rubellaCarubv10012900m.457.745Carubv10012900m.457.745Carubv10013012mCarubv10012928m
Chlamydomonas reinhardtiig13482.t1
Citrus clementinaCiclev10018711m.453.741Ciclev10018711m.453.741Ciclev10011210mCiclev10011021m
Citrus sinensisorange1.1g003557m.291.579orange1.1g003557m.291.579orange1.1g002729m.402.690orange1.1g002729m.402.690orange1.1g002431m.402.690
orange1.1g002431m.402.690orange1.1g005626morange1.1g005594morange1.1g004753morange1.1g007075m
orange1.1g002273morange1.1g003891morange1.1g002443morange1.1g002441morange1.1g002438m
orange1.1g006937morange1.1g007634m
Cucumis sativusCucsa.027630.1.563.753Cucsa.027630.1.563.753Cucsa.083560.1
Eucalyptus grandisEucgr.L00641.1.550.718Eucgr.L00641.1.550.718Eucgr.K02568.1
Fragaria vescamrna16720.1-v1.0-hybrid.551.739mrna16720.1-v1.0-hybrid.551.739mrna15637.1-v1.0-hybrid
Glycine maxGlyma10g31190.2Glyma10g31190.1.468.756Glyma10g31190.1.468.756Glyma20g36330.1.468.756Glyma20g36330.1.468.756
Glyma20g36330.2Glyma19g38241.2Glyma19g38241.1Glyma03g35610.3Glyma03g35610.2
Glyma02g36210.4Glyma02g36210.3Glyma10g08710.1
Gossypium raimondiiGorai.011G150500.2.480.766Gorai.011G150500.2.480.766Gorai.011G150500.1.481.772Gorai.011G150500.1.481.772Gorai.011G150500.3
Gorai.013G189100.3.376.564Gorai.013G189100.3.376.564Gorai.013G189100.2.571.758Gorai.013G189100.2.571.758Gorai.013G189100.1.571.758
Gorai.013G189100.1.571.758Gorai.011G150500.5.520.693Gorai.011G150500.5.520.693Gorai.011G150500.4.520.693Gorai.011G150500.4.520.693
Gorai.007G367900.2Gorai.007G367900.1Gorai.002G238200.2Gorai.002G238200.1
Linum usitatissimumLus10003576.450.737Lus10003576.450.737Lus10004779.456.744Lus10004779.456.744Lus10003113.456.744
Lus10003113.456.744Lus10021336Lus10017009
Malus domesticaMDP0000233292.459.747MDP0000233292.459.747MDP0000119499MDP0000212192MDP0000846748
Manihot esculentacassava4.1_001015m.583.740cassava4.1_001015m.583.740cassava4.1_002695m.313.473cassava4.1_002695m.313.473cassava4.1_002691m.313.473
cassava4.1_002691m.313.473cassava4.1_001021m.581.740cassava4.1_001021m.581.740cassava4.1_001222mcassava4.1_001239m
cassava4.1_001390m
Medicago truncatulaMedtr1g079510.2.224.512Medtr1g079510.2.224.512Medtr1g079510.1.466.754Medtr1g079510.1.466.754
Mimulus guttatusmgv1a000777m.468.756mgv1a000777m.468.756mgv1a000982m.534.691mgv1a000982m.534.691mgv1a000971m
Oryza sativaLOC_Os01g68680.1.495.747LOC_Os01g68680.1.495.747LOC_Os02g28830.1.255.415LOC_Os02g28830.1.255.415LOC_Os08g44510.1
Panicum virgatumPavirv00063187m.616.777Pavirv00063187m.616.777Pavirv00007611mPavirv00052192m
Physcomitrella patensPp1s263_4V6.1.478.766Pp1s263_4V6.1.478.766Pp1s177_132V6.1.476.764Pp1s177_132V6.1.476.764Pp1s346_18V6.1
Pp1s456_4V6.1Pp1s150_16V6.1
Phaseolus vulgarisPhvul.007G119800.1.469.757Phvul.007G119800.1.469.757Phvul.001G192300.2Phvul.001G192300.1Phvul.007G153100.2
Phvul.007G153100.1
Picea abiesMA_76964g0020.246.533MA_76964g0020.246.533MA_247226g0010.309.469MA_247226g0010.309.469MA_869746g0010
MA_475186g0010MA_261690g0010
Populus trichocarpaPotri.013G051400.7.84.372Potri.013G051400.7.84.372Potri.013G051400.6.224.512Potri.013G051400.6.224.512Potri.013G051400.5
Potri.013G051400.4.463.751Potri.013G051400.4.463.751Potri.013G051400.3.463.751Potri.013G051400.3.463.751Potri.013G051400.2.463.751
Potri.013G051400.2.463.751Potri.013G051400.1.463.751Potri.013G051400.1.463.751Potri.019G025600.5.224.512Potri.019G025600.5.224.512
Potri.019G025600.2.459.747Potri.019G025600.2.459.747Potri.019G025600.1.459.747Potri.019G025600.1.459.747Potri.019G025600.6.213.376
Potri.019G025600.6.213.376Potri.019G025600.4.417.580Potri.019G025600.4.417.580Potri.019G025600.3.478.641Potri.019G025600.3.478.641
Potri.006G208900.1Potri.016G075700.4Potri.016G075700.3Potri.016G075700.1Potri.016G075700.2
Potri.006G208900.3Potri.006G208900.2
Prunus persicappa000862m.459.747ppa000862m.459.747ppa001075m
Ricinus communis29680.m001749.589.74729680.m001749.589.74727556.m00005030032.m00047548742.m000013
Setaria italicaSi016363mSi016197m.619.779Si016197m.619.779Si000265m.480.641Si000265m.480.641
Si013329mSi013225m
Selaginella moellendorffii143846.391.643143846.391.643159012
Sorghum bicolorSb04g019560.1.619.779Sb04g019560.1.619.779Sb07g024110.1
Thellungiella halophilaThhalv10020104mThhalv10020000m.431.719Thhalv10020000m.431.719Thhalv10019996m.457.745Thhalv10019996m.457.745
Thhalv10020052mThhalv10020017m
Vitis viniferaGSVIVT01026359001.593.754GSVIVT01026359001.593.754GSVIVT01033891001
Volvox carteriVocar20006483m
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)