y PlantCAZyme

CAZyme Information

Basic Information
SpeciesBrachypodium distachyon
Cazyme IDBradi3g43577.3
FamilyGT41
Protein PropertiesLength: 1002 Molecular Weight: 112462 Isoelectric Point: 6.7129
ChromosomeChromosome/Scaffold: 3 Start: 45115230 End: 45125165
DescriptionTetratricopeptide repeat (TPR)-like superfamily protein
View CDS
External Links
NCBI Taxonomy
Plaza
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GT417809790
  PHKRSDYGLPEDKFIFACFNQLYKMDPEIFDRWCNILKRVPNSALWILRFPAAGETRVRAHAAARGVRSDQIIFTDVAMKTEHIRRSALADLFLDTPLCN
  AHTTGTDILWAGLPMITLPLEKMATRVAGSLCLATGLGEEMIVSSMQEYEDRAVALAQNPADLQALTNKLKSVRMTCPLFDTARWVRNLERAYYKMWNLY
GT416107690
  EGKYCRLRVGYVSSDFGNHPLSHLMGSVFGMHNRDNIEVFCYALSQNDGTEWRQRIQSEVEHFLDVSAMTSDMIARIINQDKIQILINLNGYTKGARNEI
  FALQPAPIQVSYMGFPGTTGASYIDYLVTDEFVSPSCYAHIYSEKLVHLPHCYFVNDYKQ
Full Sequence
Protein Sequence     Length: 1002     Download
MLSLQSGDSR HHAPQPRAPA PAPVLGSSDG DWLGFGLPKL EESVSSSPPS FLLPSSLSID    60
ARAQPEPKPK QLGAVDEERH LALAHQNYRS GKYREALEHG NIVYEKNPRR TDNLLLLGAI    120
YYQIRNYDMC IEKNEEALAI DPQFAECYGN MANAWKEKGD VDLAIRYYLT AIQLRSNFCD    180
AWSNLASAYT RKGRLNDAAQ CCRQALAINP RLVDAHSNLG NLMKSQGFIQ EAYSCYIEAL    240
HIDPRFAIAW SNLAGLFMEA GDLDKALLYY KEAIKLKPSF ADAHLNQGNV YKAMGKPQDA    300
IMSYQRALQA RPDYAMAYGN LATIYYEQGQ LDMAVRCYNQ AIVCDPQFIE AYNNMGNALK    360
DSGRVEEAIN CYRSCLALQA NHPQALTNLG NIYMEWNLVT TAASFYKAAI SVTSGLSSPL    420
NNLALIYKQQ GNYADAITCY TEVLRIDPTA ADALVNRGNT FKEIGRVNEA IQDYVQAATI    480
RPTMAEAHAN LASAYKDSGH VETAIVSYKQ ALHLRPDFPE AICNLLHTLQ CVCDWENRDA    540
MFRNVEDIIR RQIKMSVLPS VQPFHAIAYP IDPMLALDIS RKYAAHCSLI ASRLGLPPFV    600
HPPPVPVKAE GKYCRLRVGY VSSDFGNHPL SHLMGSVFGM HNRDNIEVFC YALSQNDGTE    660
WRQRIQSEVE HFLDVSAMTS DMIARIINQD KIQILINLNG YTKGARNEIF ALQPAPIQVS    720
YMGFPGTTGA SYIDYLVTDE FVSPSCYAHI YSEKLVHLPH CYFVNDYKQK NRDCLNPVLP    780
HKRSDYGLPE DKFIFACFNQ LYKMDPEIFD RWCNILKRVP NSALWILRFP AAGETRVRAH    840
AAARGVRSDQ IIFTDVAMKT EHIRRSALAD LFLDTPLCNA HTTGTDILWA GLPMITLPLE    900
KMATRVAGSL CLATGLGEEM IVSSMQEYED RAVALAQNPA DLQALTNKLK SVRMTCPLFD    960
TARWVRNLER AYYKMWNLYC CGRDPEPFKV KEDDGEFPFD R*                       1020
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
pfam13844Glyco_transf_412.0e-69783976194+
pfam13844Glyco_transf_411.0e-69616769155+
COG3914Spy9.0e-102421979568+
Gene Ontology
GO TermDescription
GO:0005515protein binding
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankACN26645.101100111009unknown [Zea mays]
DDBJBAD21873.1031100128953putative O-linked N-acetyl glucosamine transferase [Oryza sativa Japonica Group]
GenBankEEC73199.10311001281004hypothetical protein OsI_07263 [Oryza sativa Indica Group]
GenBankEEE57013.10311001281004hypothetical protein OsJ_06783 [Oryza sativa Japonica Group]
RefSeqXP_002453843.10101001211011hypothetical protein SORBIDRAFT_04g019560 [Sorghum bicolor]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB4gz6_D03827678390A Chain A, Structure Of Berberine Bridge Enzyme In Complex With Dehydroscoulerine
PDB4gz6_D0764986495716A Chain A, Structure Of Berberine Bridge Enzyme In Complex With Dehydroscoulerine
PDB4gz6_D3e-282103606156A Chain A, Structure Of Berberine Bridge Enzyme In Complex With Dehydroscoulerine
PDB4gz6_D4e-261422866150A Chain A, Structure Of Berberine Bridge Enzyme In Complex With Dehydroscoulerine
PDB4gz6_D5e-2518032210152A Chain A, Structure Of Berberine Bridge Enzyme In Complex With Dehydroscoulerine
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
HO79524746154210020
HO77872545055310020
HO798232410754840
HO7982323341945240
HO795247544905434e-16
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_058_00216.4.161.321Aquca_058_00216.4.161.321Aquca_058_00216.3.387.547Aquca_058_00216.3.387.547Aquca_058_00216.2
Aquca_058_00216.1.601.761Aquca_058_00216.1.601.761Aquca_072_00077.2Aquca_072_00077.3Aquca_072_00077.1
Arabidopsis lyrata896453.457.745896453.457.745478494
Arabidopsis thalianaAT3G04240.1.457.745AT3G04240.1.457.745AT3G11540.1AT3G11540.2
Brachypodium distachyonBradi3g43577.3.610.769Bradi3g43577.3.610.769Bradi3g43577.2Bradi3g43577.1Bradi5g06647.1.621.781
Bradi5g06647.1.621.781Bradi2g58616.1.592.750Bradi2g58616.1.592.750Bradi3g42910.1
Brassica rapaBra040144.586.743Bra040144.586.743Bra001408Bra034832
Carica papayaevm.model.supercontig_51.46.234.522evm.model.supercontig_51.46.234.522
Capsella rubellaCarubv10012900m.457.745Carubv10012900m.457.745Carubv10013012mCarubv10012928m
Chlamydomonas reinhardtiig13482.t1
Citrus clementinaCiclev10018711m.453.741Ciclev10018711m.453.741Ciclev10011210mCiclev10011021m
Citrus sinensisorange1.1g003557m.291.579orange1.1g003557m.291.579orange1.1g002729m.402.690orange1.1g002729m.402.690orange1.1g002431m.402.690
orange1.1g002431m.402.690orange1.1g005626morange1.1g005594morange1.1g004753morange1.1g007075m
orange1.1g002273morange1.1g003891morange1.1g002443morange1.1g002441morange1.1g002438m
orange1.1g006937morange1.1g007634m
Cucumis sativusCucsa.027630.1.563.753Cucsa.027630.1.563.753Cucsa.083560.1
Eucalyptus grandisEucgr.L00641.1.550.718Eucgr.L00641.1.550.718Eucgr.K02568.1
Fragaria vescamrna16720.1-v1.0-hybrid.551.739mrna16720.1-v1.0-hybrid.551.739mrna15637.1-v1.0-hybrid
Glycine maxGlyma10g31190.2Glyma10g31190.1.468.756Glyma10g31190.1.468.756Glyma20g36330.1.468.756Glyma20g36330.1.468.756
Glyma20g36330.2Glyma19g38241.2Glyma19g38241.1Glyma03g35610.3Glyma03g35610.2
Glyma02g36210.4Glyma02g36210.3Glyma10g08710.1
Gossypium raimondiiGorai.011G150500.2.480.766Gorai.011G150500.2.480.766Gorai.011G150500.1.481.772Gorai.011G150500.1.481.772Gorai.011G150500.3
Gorai.013G189100.3.376.564Gorai.013G189100.3.376.564Gorai.013G189100.2.571.758Gorai.013G189100.2.571.758Gorai.013G189100.1.571.758
Gorai.013G189100.1.571.758Gorai.011G150500.5.520.693Gorai.011G150500.5.520.693Gorai.011G150500.4.520.693Gorai.011G150500.4.520.693
Gorai.007G367900.2Gorai.007G367900.1Gorai.002G238200.2Gorai.002G238200.1
Linum usitatissimumLus10003576.450.737Lus10003576.450.737Lus10004779.456.744Lus10004779.456.744Lus10003113.456.744
Lus10003113.456.744Lus10021336Lus10017009
Malus domesticaMDP0000233292.459.747MDP0000233292.459.747MDP0000119499MDP0000212192MDP0000846748
Manihot esculentacassava4.1_001015m.583.740cassava4.1_001015m.583.740cassava4.1_002695m.313.473cassava4.1_002695m.313.473cassava4.1_002691m.313.473
cassava4.1_002691m.313.473cassava4.1_001021m.581.740cassava4.1_001021m.581.740cassava4.1_001222mcassava4.1_001239m
cassava4.1_001390m
Medicago truncatulaMedtr1g079510.2.224.512Medtr1g079510.2.224.512Medtr1g079510.1.466.754Medtr1g079510.1.466.754
Mimulus guttatusmgv1a000777m.468.756mgv1a000777m.468.756mgv1a000982m.534.691mgv1a000982m.534.691mgv1a000971m
Oryza sativaLOC_Os01g68680.1.495.747LOC_Os01g68680.1.495.747LOC_Os02g28830.1.255.415LOC_Os02g28830.1.255.415LOC_Os08g44510.1
Panicum virgatumPavirv00063187m.616.777Pavirv00063187m.616.777Pavirv00007611mPavirv00052192m
Physcomitrella patensPp1s263_4V6.1.478.766Pp1s263_4V6.1.478.766Pp1s177_132V6.1.476.764Pp1s177_132V6.1.476.764Pp1s346_18V6.1
Pp1s456_4V6.1Pp1s150_16V6.1
Phaseolus vulgarisPhvul.007G119800.1.469.757Phvul.007G119800.1.469.757Phvul.001G192300.2Phvul.001G192300.1Phvul.007G153100.2
Phvul.007G153100.1
Picea abiesMA_76964g0020.246.533MA_76964g0020.246.533MA_247226g0010.309.469MA_247226g0010.309.469MA_869746g0010
MA_475186g0010MA_261690g0010
Populus trichocarpaPotri.013G051400.7.84.372Potri.013G051400.7.84.372Potri.013G051400.6.224.512Potri.013G051400.6.224.512Potri.013G051400.5
Potri.013G051400.4.463.751Potri.013G051400.4.463.751Potri.013G051400.3.463.751Potri.013G051400.3.463.751Potri.013G051400.2.463.751
Potri.013G051400.2.463.751Potri.013G051400.1.463.751Potri.013G051400.1.463.751Potri.019G025600.5.224.512Potri.019G025600.5.224.512
Potri.019G025600.2.459.747Potri.019G025600.2.459.747Potri.019G025600.1.459.747Potri.019G025600.1.459.747Potri.019G025600.6.213.376
Potri.019G025600.6.213.376Potri.019G025600.4.417.580Potri.019G025600.4.417.580Potri.019G025600.3.478.641Potri.019G025600.3.478.641
Potri.006G208900.1Potri.016G075700.4Potri.016G075700.3Potri.016G075700.1Potri.016G075700.2
Potri.006G208900.3Potri.006G208900.2
Prunus persicappa000862m.459.747ppa000862m.459.747ppa001075m
Ricinus communis29680.m001749.589.74729680.m001749.589.74727556.m00005030032.m00047548742.m000013
Setaria italicaSi016363mSi016197m.619.779Si016197m.619.779Si000265m.480.641Si000265m.480.641
Si013329mSi013225m
Selaginella moellendorffii143846.391.643143846.391.643159012
Sorghum bicolorSb04g019560.1.619.779Sb04g019560.1.619.779Sb07g024110.1
Thellungiella halophilaThhalv10020104mThhalv10020000m.431.719Thhalv10020000m.431.719Thhalv10019996m.457.745Thhalv10019996m.457.745
Thhalv10020052mThhalv10020017m
Vitis viniferaGSVIVT01026359001.593.754GSVIVT01026359001.593.754GSVIVT01033891001
Volvox carteriVocar20006483m
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)