y PlantCAZyme

CAZyme Information

Basic Information
SpeciesBrachypodium distachyon
Cazyme IDBradi3g44760.1
FamilyGH13
Protein PropertiesLength: 836 Molecular Weight: 94212.6 Isoelectric Point: 5.947
ChromosomeChromosome/Scaffold: 3 Start: 46716583 End: 46727241
Descriptionstarch branching enzyme 2.2
View CDS
External Links
NCBI Taxonomy
Plaza
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GH133506708.8e-33
  LPRIKKLGYNAVQIMAIQEHSYYGSFGYHVTNFFAPSSRFGTPEDLKSLIDRAHELGLVVLMDVVHSHASSNTLDGLNGFDGTDTHYFHGGARGHHWMWD
  SRVFNYGNWEVIRYLLSNARWWLEEYKFDGFRFDGVTSMMYTHHGLQVTFSGDYNEYFGFNTDVDAVVYLMLVNDLIHGLYPEAITIGEDVSGMPTFALP
  VQVGGVGFDYRLHMAVADKWIELFKRSDESWQMGDIVHTLTNRRWLEKCVTYAESHDQALVGDKTIAFWLMDKDMYDFMALDRPSTPNIDRGIALHKMIR
  LITMGLGGEGYLNFMGNEFGH
Full Sequence
Protein Sequence     Length: 836     Download
MMASPAFAVV SGAGLGGAPA PPRSGAADRR RRGLQLPLLF GRDKGSCFPH AIRVASSGRR    60
VVMRVGGVSG EVTIPDGKSD GMLSSDGSAQ FQSDDLEVPS IDDELSIEGG NEGNIESSET    120
DQGTEESNVE GMNKMAKESA AGEKLRVIPP PGNGEQIYEI DPTLKAYKYH LEYRYSLYRR    180
VRSDIDQHEG GMDAFSRGYE NFGFNRSAEG ITYREWAPGA LSAALVGDFN NWDPNADRMS    240
KNDFGIWEIF LPNNADGSTP IPHGSRVKVR MDTPSGIKDS IPAWIKYSVQ APGDIPYNGI    300
YYDPPEDEKY VFKHPQPKRP KSLRIYETHV GMSSPEPKIN TYANFRDEVL PRIKKLGYNA    360
VQIMAIQEHS YYGSFGYHVT NFFAPSSRFG TPEDLKSLID RAHELGLVVL MDVVHSHASS    420
NTLDGLNGFD GTDTHYFHGG ARGHHWMWDS RVFNYGNWEV IRYLLSNARW WLEEYKFDGF    480
RFDGVTSMMY THHGLQVTFS GDYNEYFGFN TDVDAVVYLM LVNDLIHGLY PEAITIGEDV    540
SGMPTFALPV QVGGVGFDYR LHMAVADKWI ELFKRSDESW QMGDIVHTLT NRRWLEKCVT    600
YAESHDQALV GDKTIAFWLM DKDMYDFMAL DRPSTPNIDR GIALHKMIRL ITMGLGGEGY    660
LNFMGNEFGH PEWIDFPRGP QVLPSGKFIP GNNNSYDKCR RRFDLGDAEF LRYHGMQLFD    720
EAMQHLEEKY GYMTSGHQYI SRKHEEDKVI VFEKGELVFV FNFHCSNSYF DYRVGCLKPG    780
KYKVVLDSDA GVFGGFGRIH HTADHFTSDC QHDNRPHSFS VYTPSRTCVV YAPMN*        840
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
PLN02960PLN029602.0e-916525193+
PLN03244PLN032445.0e-135261831577+
PLN02447PLN024470138833700+
cd11321AmyAc_bac_euk_BE0306720416+
PLN02960PLN029600261831576+
Gene Ontology
GO TermDescription
GO:0003824catalytic activity
GO:0004553hydrolase activity, hydrolyzing O-glycosyl compounds
GO:0005975carbohydrate metabolic process
GO:0043169cation binding
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankAAC69754.101983516829starch branching enzyme IIb [Hordeum vulgare subsp. vulgare]
GenBankAAW80631.101983516836starch branching enzyme IIb [Triticum aestivum]
GenBankACE88265.1028331823rice starch branching enzyme [Oryza sativa Japonica Group]
GenBankEAY86110.1028331823hypothetical protein OsI_07480 [Oryza sativa Indica Group]
RefSeqNP_001047009.1028331823Os02g0528200 [Oryza sativa (japonica cultivar-group)]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB3amk_A015783113690A Chain A, Structure Of The Starch Branching Enzyme I (Bei) From Oryza Sativa L
PDB3aml_A015783113690A Chain A, Structure Of The Starch Branching Enzyme I (Bei) From Oryza Sativa L
PDB3vu2_B015783113690A Chain A, Structure Of The Starch Branching Enzyme I (bei) Complexed With Maltopentaose From Oryza Sativa L
PDB3vu2_A015783113690A Chain A, Structure Of The Starch Branching Enzyme I (bei) Complexed With Maltopentaose From Oryza Sativa L
PDB3k1d_A1.4013e-45210833137721A Chain A, Crystal Structure Of Glycogen Branching Enzyme Synonym: 1,4- Glucan:1,4-Alpha-D-Glucan 6-Glucosyl-Transferase From Mycob Tuberculosis H3
Metabolic Pathways
Pathway NameReactionECProtein Name
starch biosynthesisRXN-7710EC-2.4.1.181,4-α-glucan branching enzyme
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
HO7945366821518320
HO7776386262078320
HO4581233954408340
HO4581232891514380
HO777638471602060.00000007
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_066_00053.1Aquca_027_00415.5Aquca_027_00415.4Aquca_027_00415.3Aquca_027_00415.2
Aquca_027_00415.1Aquca_015_00400.6Aquca_015_00400.5Aquca_015_00400.2Aquca_015_00400.1
Aquca_015_00400.3Aquca_015_00400.4
Arabidopsis lyrata873536321348908239
Arabidopsis thalianaAT3G20440.3AT3G20440.2AT2G36390.1AT5G03650.1
Brachypodium distachyonBradi1g41970.2Bradi1g41970.1Bradi1g29850.2Bradi1g29850.1Bradi5g09170.2
Bradi5g09170.1
Brassica rapaBra035782Bra005269Bra017241Bra009521
Carica papayaevm.model.supercontig_5.62
Capsella rubellaCarubv10012936mCarubv10022617mCarubv10000235m
Chlamydomonas reinhardtiiCre06.g270100.t1.3Cre10.g444700.t1.1Cre06.g289850.t1.3Cre08.g373450.t1.1
Citrus clementinaCiclev10007401mCiclev10011063mCiclev10000406mCiclev10000374mCiclev10000272m
Ciclev10000256m
Citrus sinensisorange1.1g035501morange1.1g002609morange1.1g004765morange1.1g004253morange1.1g003474m
orange1.1g003390morange1.1g003230morange1.1g003226m
Cucumis sativusCucsa.378410.2Cucsa.378410.1Cucsa.077550.3Cucsa.077550.1Cucsa.077550.2
Eucalyptus grandisEucgr.F03487.1Eucgr.A01533.1Eucgr.F01770.1
Fragaria vescamrna30233.1-v1.0-hybridmrna08644.1-v1.0-hybridmrna08646.1-v1.0-hybrid
Glycine maxGlyma18g10385.1Glyma03g35020.2Glyma03g35020.1Glyma19g37750.2Glyma19g37750.1
Glyma04g01950.2
Gossypium raimondiiGorai.009G406400.4Gorai.011G196000.5Gorai.011G196000.4Gorai.011G196000.3Gorai.011G196000.2
Gorai.011G196000.12Gorai.011G196000.1Gorai.011G196000.7Gorai.011G196000.6Gorai.011G196000.13
Gorai.002G172100.7Gorai.002G172100.5Gorai.002G172100.3Gorai.002G172100.2Gorai.002G172100.1
Gorai.009G441800.2Gorai.009G441800.1Gorai.009G406400.6Gorai.009G406400.5Gorai.009G406400.3
Gorai.009G406400.2Gorai.009G406400.1Gorai.002G241400.7Gorai.002G241400.6Gorai.002G241400.5
Gorai.002G241400.4Gorai.002G241400.2Gorai.002G241400.1Gorai.005G113800.3Gorai.005G113800.2
Gorai.005G113800.1
Linum usitatissimumLus10000912Lus10023878Lus10014382Lus10016012Lus10012264
Malus domesticaMDP0000218396MDP0000148418MDP0000214735MDP0000177786
Manihot esculentacassava4.1_006199mcassava4.1_004366mcassava4.1_003773mcassava4.1_001701mcassava4.1_001686m
cassava4.1_002337mcassava4.1_002172mcassava4.1_002171mcassava4.1_001826mcassava4.1_001598m
cassava4.1_001595m
Medicago truncatulaMedtr7g104080.1
Mimulus guttatusmgv1a001162mmgv1a001301mmgv1a001932m
Oryza sativaLOC_Os02g32660.2LOC_Os06g26234.3LOC_Os06g26234.2LOC_Os06g26234.1LOC_Os02g32660.1
LOC_Os06g51084.8LOC_Os06g51084.7LOC_Os06g51084.6LOC_Os06g51084.5LOC_Os06g51084.4
LOC_Os06g51084.3LOC_Os06g51084.2LOC_Os06g51084.1
Panicum virgatumPavirv00035568mPavirv00058932mPavirv00002278mPavirv00067040mPavirv00061484m
Pavirv00061483mPavirv00061485m
Physcomitrella patensPp1s200_23V6.1Pp1s15_181V6.2Pp1s15_181V6.1Pp1s54_189V6.2Pp1s54_189V6.1
Pp1s64_78V6.1
Phaseolus vulgarisPhvul.006G047000.1Phvul.001G187600.1Phvul.009G011000.1
Picea abiesMA_10430611g0010
Populus trichocarpaPotri.006G115100.5Potri.001G359200.1Potri.006G115100.6Potri.006G115100.4Potri.006G115100.3
Potri.006G115100.2Potri.006G115100.1Potri.005G251000.5Potri.005G251000.4Potri.005G251000.3
Potri.005G251000.2Potri.005G251000.1Potri.005G251000.6
Prunus persicappa016544mppa001312mppa001929m
Ricinus communis29762.m00048630170.m01435927496.m000095
Setaria italicaSi008087mSi016350mSi009379mSi009312mSi005911m
Si006006mSi006081m
Selaginella moellendorffii165481437348437417
Sorghum bicolorSb03g027310.1Sb04g021540.1Sb06g015360.1Sb10g030776.1
Thellungiella halophilaThhalv10020019mThhalv10016249mThhalv10012785mThhalv10012784mThhalv10012679m
Vitis viniferaGSVIVT01037695001GSVIVT01033801001GSVIVT01008673001
Volvox carteriVocar20012173mVocar20015251mVocar20002436mVocar20007338m
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)