y PlantCAZyme

CAZyme Information

Basic Information
SpeciesBrachypodium distachyon
Cazyme IDBradi3g45190.1
FamilyAA1
Protein PropertiesLength: 607 Molecular Weight: 66973.2 Isoelectric Point: 6.6856
ChromosomeChromosome/Scaffold: 3 Start: 47135748 End: 47138113
Descriptionlaccase 7
View CDS
External Links
NCBI Taxonomy
Plaza
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
AA1295860
  AAVVEHTFVVTQVRMRHLCNDTLVTVVNGQFPGPALEATEGDTVVVHVVNESPHGITIHWHGVKQRLSCWADGAGMVTQCPIQPNTTFTYRFEVGDQVGT
  LWWHAHVSSLRATLHGIIIIRPKSGAYPFLKPDMDVPVIISEWWQRDLIKVDKNFSTGGNFDDNPAAAAINGKLGDLYNCSGIIEDNFVLDVEPGKTYLL
  RLVNAALFSEYYFKVAGHKLTVVGSDANYVRPYTTDVIAVGAGETIDVLMVADAPPCQYYMAALANQPPPPDPQIPVFASRALIQYTNISSNHAARHSCG
  KEPLMPDMPSQHDTITTVYFHGNLTGLPGHPLLPQIRGPVHEHLYLALGKGSMCTDRNKTSCKRGGNPESFEVAYINNVSFHLPEKTSLLEARYYGRTMN
  NSDHNWNSGVPVEDLPSKPPRAFNYTDNALIPVAGNVKLEELEPTRKATMTRRFRYNTTVEVVFQSTATMQSDSNPMHLHGHDFFVLAHGHGNYDARRDV
  KSYNLVDPPMKNTVQVPRLGWAAIRFVADNPGAWFMHCHFEFHIAMGMAAVFEVENGP
Full Sequence
Protein Sequence     Length: 607     Download
MSKMLRMAAG VFFFLFAVAL SSAGAGSDAA VVEHTFVVTQ VRMRHLCNDT LVTVVNGQFP    60
GPALEATEGD TVVVHVVNES PHGITIHWHG VKQRLSCWAD GAGMVTQCPI QPNTTFTYRF    120
EVGDQVGTLW WHAHVSSLRA TLHGIIIIRP KSGAYPFLKP DMDVPVIISE WWQRDLIKVD    180
KNFSTGGNFD DNPAAAAING KLGDLYNCSG IIEDNFVLDV EPGKTYLLRL VNAALFSEYY    240
FKVAGHKLTV VGSDANYVRP YTTDVIAVGA GETIDVLMVA DAPPCQYYMA ALANQPPPPD    300
PQIPVFASRA LIQYTNISSN HAARHSCGKE PLMPDMPSQH DTITTVYFHG NLTGLPGHPL    360
LPQIRGPVHE HLYLALGKGS MCTDRNKTSC KRGGNPESFE VAYINNVSFH LPEKTSLLEA    420
RYYGRTMNNS DHNWNSGVPV EDLPSKPPRA FNYTDNALIP VAGNVKLEEL EPTRKATMTR    480
RFRYNTTVEV VFQSTATMQS DSNPMHLHGH DFFVLAHGHG NYDARRDVKS YNLVDPPMKN    540
TVQVPRLGWA AIRFVADNPG AWFMHCHFEF HIAMGMAAVF EVENGPTLEM SLPPPPLDLP    600
KCTQHE*                                                              660
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
pfam07732Cu-oxidase_34.0e-4637153119+
PLN02354PLN023546.0e-5152562526+
PLN02191PLN021919.0e-8447580558+
TIGR03388ascorbase4.0e-9647581558+
TIGR03389laccase034602574+
Gene Ontology
GO TermDescription
GO:0005507copper ion binding
GO:0016491oxidoreductase activity
GO:0055114oxidation-reduction process
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankAAL73969.103358926559AF465469_1 laccase LAC2-1 [Lolium perenne]
RefSeqNP_001067650.1015851570Os11g0264000 [Oryza sativa (japonica cultivar-group)]
RefSeqNP_001068353.102858527565Os11g0641500 [Oryza sativa (japonica cultivar-group)]
RefSeqNP_001130676.102560622599hypothetical protein LOC100191779 [Zea mays]
RefSeqXP_002457562.1016061597hypothetical protein SORBIDRAFT_03g009410 [Sorghum bicolor]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB1asq_B04758019521A Chain A, Crystal Structure Of A Glycyl Radical Enzyme From Archaeoglobus Fulgidus
PDB1asq_A04758019521A Chain A, Crystal Structure Of A Glycyl Radical Enzyme From Archaeoglobus Fulgidus
PDB1asp_B04758019521A Chain A, Crystal Structure Of A Glycyl Radical Enzyme From Archaeoglobus Fulgidus
PDB1asp_A04758019521A Chain A, Crystal Structure Of A Glycyl Radical Enzyme From Archaeoglobus Fulgidus
PDB1aso_B04758019521A Chain A, Crystal Structure Of A Glycyl Radical Enzyme From Archaeoglobus Fulgidus
Transmembrane Domains
StartEnd
726
Signal Peptide
Cleavage Site
23
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
EE013225212332420
EG387254252332840
HX190751248372840
FL904583248332800
DV532531233332640
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_009_00804.1Aquca_009_00807.1Aquca_009_00807.2
Arabidopsis lyrata478237472269486975
Arabidopsis thalianaAT3G09220.1AT5G01040.1AT5G01050.1
Brachypodium distachyonBradi4g39330.1Bradi2g55050.1Bradi2g55060.1Bradi4g11827.1Bradi4g11850.1
Bradi1g10567.1Bradi3g22317.1Bradi4g11780.1Bradi4g11770.1Bradi4g11840.1
Bradi3g02290.1Bradi3g02300.1
Brassica rapaBra029753Bra028885Bra005699
Capsella rubellaCarubv10016347mCarubv10000548m
Glycine maxGlyma01g26750.1Glyma03g15800.5Glyma03g15805.1Glyma01g26750.2Glyma07g17170.1
Glyma18g41886.1Glyma18g41860.1Glyma07g17150.1Glyma18g41870.1
Malus domesticaMDP0000291183
Manihot esculentacassava4.1_006971m
Oryza sativaLOC_Os01g63200.1LOC_Os01g63190.1LOC_Os11g42200.1LOC_Os11g42220.1LOC_Os11g16260.1
LOC_Os10g20610.1
Panicum virgatumPavirv00040765mPavirv00049024mPavirv00038281mPavirv00007769mPavirv00063349m
Pavirv00062920mPavirv00053056mPavirv00047982mPavirv00069158mPavirv00051794m
Pavirv00019186mPavirv00057102mPavirv00039741mPavirv00033330mPavirv00023383m
Pavirv00050058mPavirv00043455mPavirv00033589mPavirv00032842mPavirv00018047m
Pavirv00032841mPavirv00054602mPavirv00028624mPavirv00051105mPavirv00056353m
Pavirv00054858mPavirv00054859m
Phaseolus vulgarisPhvul.010G005900.1Phvul.008G112100.1
Setaria italicaSi021601mSi020688mSi027309mSi021573mSi021628m
Si004353mSi000613mSi026121mSi028303mSi027928m
Si009653mSi026113mSi028115mSi027394mSi026118m
Si026123mSi026150mSi026109mSi028248mSi027660m
Si026140mSi027267mSi026136mSi027586mSi026159m
Si026153mSi026117mSi028198mSi026161mSi026162m
Si008101mSi026299mSi026376mSi026137mSi024846m
Si001570mSi001277mSi001174mSi027990m.20.264Si027990m.20.264
Si027990m.273.533Si027990m.273.533
Sorghum bicolorSb08g011530.1Sb03g039960.1Sb03g039980.1Sb03g039970.1Sb05g026630.1
Sb03g009410.1Sb05g025570.1Sb02g000300.1
Thellungiella halophilaThhalv10020392mThhalv10020388mThhalv10013097mThhalv10013058mThhalv10015329m
Zea maysAC234190.1_FGT002
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)