y PlantCAZyme

CAZyme Information

Basic Information
SpeciesBrachypodium distachyon
Cazyme IDBradi3g49085.1
FamilyAA3
Protein PropertiesLength: 767 Molecular Weight: 82477.3 Isoelectric Point: 7.9661
ChromosomeChromosome/Scaffold: 3 Start: 50467088 End: 50470479
DescriptionLong-chain fatty alcohol dehydrogenase family protein
View CDS
External Links
NCBI Taxonomy
Plaza
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
AA32437603.36312e-44
  VECDVAIVGSGCGGGVTAAVLAAAGHKVVVIEKGSYFTSKDYTSIEGPSMRQLYESGGFVSTLSGSGLILAGSTVGGGSAVNWSACIKTPESVRGEWAGA
  HGGLPLFASPEYTAAMDAVFRRLGVTSGCQEEGLQNKVLRKGCEKLGYKVEPVSRNSSEGHFCGSCGYGCRTGDKRGTDTTWLVDAVRRGAVILTGCKAE
  KLLFSDYATAMTSAEKKKKKRCVGVVVATSSNPAITRKVEVRAKVTVSACGSLLTPVLLRDSGLANPHIGKNLHLHPTAMAWGYFPEDTRPDLKGKMYEG
  GIITSIHKVEGVDGVPPRAILETPLMGVAAAGTQFPWVSGRDMKERMLKYGRSVHIFSLVRDRGSGTVHGERRIAYHMDPADRENQREGLRRALRVLVAA
  GATEIGTHRSDGQRMKCKGATEEEVEEFLDGVTVLRGPQSKSENWSLCCTAHQMGSCRMAATALDGAVDARGESWEAERLYVCDASVLPSAVGVNPMITI
  QAVAYCLANGIAEQLKRD
Full Sequence
Protein Sequence     Length: 767     Download
MEEAKKQRMR QGHPLLRGGG GVSRSSYTHG FSATQMLALT AACGALVPSL PPDDAGSKAV    60
REFFLASAAD PPVPDEVAQL MSAMCLREAL ALIRTLLWLL GTRLGTLALC GSRCLSWQAP    120
FVRRFAEMPV ERREDALRRW SRETVLPPLR LFFLLLKVFC LYVFYSRIDE NSENPHWGAI    180
GYTPATDEAS AEEEEEKEQP TTKRPLDDGV VETIHHTDAS LPACLADKGL TVTEDAARNL    240
FRVECDVAIV GSGCGGGVTA AVLAAAGHKV VVIEKGSYFT SKDYTSIEGP SMRQLYESGG    300
FVSTLSGSGL ILAGSTVGGG SAVNWSACIK TPESVRGEWA GAHGGLPLFA SPEYTAAMDA    360
VFRRLGVTSG CQEEGLQNKV LRKGCEKLGY KVEPVSRNSS EGHFCGSCGY GCRTGDKRGT    420
DTTWLVDAVR RGAVILTGCK AEKLLFSDYA TAMTSAEKKK KKRCVGVVVA TSSNPAITRK    480
VEVRAKVTVS ACGSLLTPVL LRDSGLANPH IGKNLHLHPT AMAWGYFPED TRPDLKGKMY    540
EGGIITSIHK VEGVDGVPPR AILETPLMGV AAAGTQFPWV SGRDMKERML KYGRSVHIFS    600
LVRDRGSGTV HGERRIAYHM DPADRENQRE GLRRALRVLV AAGATEIGTH RSDGQRMKCK    660
GATEEEVEEF LDGVTVLRGP QSKSENWSLC CTAHQMGSCR MAATALDGAV DARGESWEAE    720
RLYVCDASVL PSAVGVNPMI TIQAVAYCLA NGIAEQLKRD LASGKN*                  780
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
pfam05199GMC_oxred_C2.0e-1769274958+
COG2303BetA2.0e-24314755475+
pfam00732GMC_oxred_N5.0e-76295520229+
Gene Ontology
GO TermDescription
GO:0016614oxidoreductase activity, acting on CH-OH group of donors
GO:0050660flavin adenine dinucleotide binding
GO:0055114oxidation-reduction process
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankACN27562.10107667768unknown [Zea mays]
GenBankEEC73620.1027573765hypothetical protein OsI_08118 [Oryza sativa Indica Group]
RefSeqNP_001047464.1027573765Os02g0621800 [Oryza sativa (japonica cultivar-group)]
RefSeqXP_002454188.10107596765hypothetical protein SORBIDRAFT_04g026370 [Sorghum bicolor]
RefSeqXP_002454190.10107596772hypothetical protein SORBIDRAFT_04g026390 [Sorghum bicolor]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB3t37_A0.0000524475617519A Chain A, Crystal Structure Of Pyridoxine 4-Oxidase From Mesorbium Loti
PDB3nne_H0.0004435745226518A Chain A, Crystal Structure Of Choline Oxidase S101a Mutant
PDB3nne_G0.0004435745226518A Chain A, Crystal Structure Of Choline Oxidase S101a Mutant
PDB3nne_F0.0004435745226518A Chain A, Crystal Structure Of Choline Oxidase S101a Mutant
PDB3nne_E0.0004435745226518A Chain A, Crystal Structure Of Choline Oxidase S101a Mutant
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
HO79475375967570
DV4838872731674390
HO7792244722156860
CB6765422603105680
DV475899286763610
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_089_00009.1Aquca_049_00132.1Aquca_034_00307.1Aquca_034_00304.1
Arabidopsis lyrata914728491906479855470376
Arabidopsis thalianaAT4G19380.1AT4G28570.1AT3G23410.1AT1G03990.1
Brachypodium distachyonBradi3g28677.1Bradi3g28657.1
Brassica rapaBra012548Bra024190Bra013391Bra015283Bra001912
Bra014947
Carica papayaevm.model.supercontig_165.33evm.model.supercontig_44.31evm.model.supercontig_2124.1
Capsella rubellaCarubv10004418mCarubv10004208mCarubv10012453mCarubv10004212mCarubv10013046m
Citrus clementinaCiclev10011111mCiclev10004403mCiclev10004405mCiclev10018992m
Citrus sinensisorange1.1g003990morange1.1g004496m
Cucumis sativusCucsa.037200.2Cucsa.037200.1Cucsa.035240.1Cucsa.255570.1
Eucalyptus grandisEucgr.H03017.2Eucgr.H03017.1Eucgr.H00753.1Eucgr.K02114.1Eucgr.D02566.1
Eucgr.D02568.1
Fragaria vescamrna08288.1-v1.0-hybridmrna11513.1-v1.0-hybridmrna08285.1-v1.0-hybrid
Glycine maxGlyma09g35210.2Glyma01g35620.1Glyma16g16415.1Glyma16g08300.2Glyma10g32640.2
Glyma12g15940.1Glyma19g34960.1Glyma06g42400.2Glyma03g32220.2
Gossypium raimondiiGorai.001G179800.3Gorai.001G179800.2Gorai.001G179800.1Gorai.011G177100.3Gorai.011G177100.2
Gorai.011G177100.1Gorai.006G252500.1
Linum usitatissimumLus10003621Lus10024922Lus10035673Lus10008239Lus10022903
Lus10037257Lus10011800
Malus domesticaMDP0000233110MDP0000173300MDP0000208936MDP0000197715
Manihot esculentacassava4.1_004067mcassava4.1_002349mcassava4.1_002619mcassava4.1_002379mcassava4.1_025870m
Medicago truncatulaMedtr5g025650.1Medtr8g072210.1Medtr4g081080.1Medtr1g075650.1Medtr4g080890.1
Mimulus guttatusmgv1a001761mmgv1a022390mmgv1a001868mmgv1a001883mmgv1a001896m
Oryza sativaLOC_Os10g33540.1LOC_Os10g33520.1LOC_Os10g33460.1LOC_Os02g40840.1
Panicum virgatumPavirv00054947m
Physcomitrella patensPp1s58_61V6.1Pp1s7_216V6.1Pp1s48_250V6.1Pp1s2_413V6.1
Phaseolus vulgarisPhvul.002G122600.1Phvul.003G278200.1Phvul.007G124200.1Phvul.001G162800.1Phvul.011G136600.1
Picea abiesMA_10427118g0010MA_9032943g0010MA_9483g0010MA_10427421g0010MA_242814g0010
Populus trichocarpaPotri.004G234900.2Potri.004G234900.1Potri.010G069100.1Potri.008G169300.1Potri.002G259700.1
Prunus persicappa014756mppa018458mppa021498m
Ricinus communis29827.m00265529981.m00058628492.m000467
Setaria italicaSi034362mSi034354mSi034359mSi016380m
Selaginella moellendorffii1140891168557460173531
Sorghum bicolorSb01g019470.1Sb01g019460.1Sb01g019480.1Sb04g026370.1Sb04g026390.1
Thellungiella halophilaThhalv10024717mThhalv10024496mThhalv10024528mThhalv10020141mThhalv10006882m
Vitis viniferaGSVIVT01036891001GSVIVT01027855001GSVIVT01028371001
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)