y PlantCAZyme

CAZyme Information

Basic Information
SpeciesBrachypodium distachyon
Cazyme IDBradi3g49560.1
FamilyGT1
Protein PropertiesLength: 507 Molecular Weight: 54298.7 Isoelectric Point: 7.5253
ChromosomeChromosome/Scaffold: 3 Start: 50894998 End: 50898045
DescriptionUDP-Glycosyltransferase superfamily protein
View CDS
External Links
NCBI Taxonomy
Plaza
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GT12944632e-29
  MWQADGSCMDWLDQQRPGSVIYVSFGTWVAPIGRDEINELALGLQATGRPFLWVLKNDPSWRAGLPAGYLETVVGRGKIVAWAPQGGVLGHEAVGCYLTH
  CGWNSTLEAIQNGVRLLCYPVSGDQFINSAFVVKMWEIGIRLPSNGQGDVRDCIERIMEGEDGKRLRGKV
Full Sequence
Protein Sequence     Length: 507     Download
MGAEPAGLVG LAAVLVPFPA QGHVTPMLQL ARALSARGVA ATVAVPDFVH RRMGGQQACN    60
ADADAGTGVA LVSIPSGVVP ADDDAPSFAS IVRAMEHHMP AHLEQMLLTR ARAGRAAGLV    120
VVIDVLASWA IPVATRCGVP AVGFWPAMLA TFRVVSAIPE LLSKGLISDS GIPILTEKFK    180
EDEANADLQI ANNLQILPEA LQLGTKEMLP WLVGCAATQE ARFAFWLQIL QRAKSLRCIL    240
VNSFHGEAPG LQDSKPHHAS QGMQILQIGP LLSDGLDSLK GHPQKLPATK NPSMWQADGS    300
CMDWLDQQRP GSVIYVSFGT WVAPIGRDEI NELALGLQAT GRPFLWVLKN DPSWRAGLPA    360
GYLETVVGRG KIVAWAPQGG VLGHEAVGCY LTHCGWNSTL EAIQNGVRLL CYPVSGDQFI    420
NSAFVVKMWE IGIRLPSNGQ GDVRDCIERI MEGEDGKRLR GKVNGLRERV MVGEARSVAK    480
RNLDAFVRGI KRDGVSASRD LGLWYP*                                        540
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
PLN02555PLN025550.0004155339+
PLN02555PLN025552.0e-44229492286+
PLN02448PLN024485.0e-4914490503+
PLN02410PLN024108.0e-531491499+
PLN02562PLN025628.0e-16114491484+
Gene Ontology
GO TermDescription
GO:0008152metabolic process
GO:0016758transferase activity, transferring hexosyl groups
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
DDBJBAD25308.101549122514putative indole-3-acetate beta-glucosyltransferase [Oryza sativa Japonica Group]
EMBLCAE05637.201249311524OSJNBa0038O10.3 [Oryza sativa (japonica cultivar-group)]
EMBLCAH67889.101249311524OSIGBa0153E02-OSIGBa0093I20.18 [Oryza sativa (indica cultivar-group)]
GenBankEAZ23914.101549122514hypothetical protein OsJ_07635 [Oryza sativa Japonica Group]
RefSeqXP_002454220.101449319515hypothetical protein SORBIDRAFT_04g026870 [Sorghum bicolor]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB2pq6_A01346911455A Chain A, Crystal Structure Of Medicago Truncatula Ugt85h2- Insights Into The Structural Basis Of A Multifunctional (Iso) Flavonoid Glycosyltransferase
PDB2c9z_A5e-405046854427A Chain A, Crystal Structure Of Medicago Truncatula Ugt85h2- Insights Into The Structural Basis Of A Multifunctional (Iso) Flavonoid Glycosyltransferase
PDB2c1z_A5e-405046854427A Chain A, Crystal Structure Of Medicago Truncatula Ugt85h2- Insights Into The Structural Basis Of A Multifunctional (Iso) Flavonoid Glycosyltransferase
PDB2c1x_A5e-405046854427A Chain A, Structure And Activity Of A Flavonoid 3-O Glucosyltransferase Reveals The Basis For Plant Natural Product Modification
PDB2vg8_A6e-361548611465A Chain A, Structure And Activity Of A Flavonoid 3-O Glucosyltransferase Reveals The Basis For Plant Natural Product Modification
Metabolic Pathways
Pathway NameReactionECProtein Name
cytokinins-O-glucoside biosynthesisRXN-4723EC-2.4.1.203trans-zeatin O-β-D-glucosyltransferase
cytokinins-O-glucoside biosynthesisRXN-4726EC-2.4.1UDP-glucose:dihydrozeatin O-β-D-glucosyltransferase
cytokinins-O-glucoside biosynthesisRXN-4735EC-2.4.1.215cis-zeatin O-β-D-glucosyltransferase
cytokinins-O-glucoside biosynthesisRXN-4737EC-2.4.1dihydrozeatin-9-N-glucoside O-β-D-glucosyltransferase
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
CB6594662162784930
DY6884492012904900
CI1453801972974930
CI2769031923024930
CB6666041923024930
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_034_00241.1
Arabidopsis lyrata359787898691
Arabidopsis thalianaAT3G22250.1
Brachypodium distachyonBradi5g16210.1
Brassica rapaBra031343Bra023841
Carica papayaevm.TU.contig_33896.1
Capsella rubellaCarubv10015270m
Citrus clementinaCiclev10011626m
Citrus sinensisorange1.1g011687m
Cucumis sativusCucsa.058490.1
Eucalyptus grandisEucgr.A00895.1Eucgr.A00894.1
Fragaria vescamrna24330.1-v1.0-hybrid
Glycine maxGlyma14g00550.1
Gossypium raimondiiGorai.001G212900.1
Linum usitatissimumLus10031068
Malus domesticaMDP0000428660MDP0000804900
Manihot esculentacassava4.1_025922m
Medicago truncatulaMedtr5g098960.1
Mimulus guttatusmgv1a006836m
Oryza sativaLOC_Os04g44354.3LOC_Os04g44354.1LOC_Os02g42280.1
Panicum virgatumPavirv00063473mPavirv00056969mPavirv00014153mPavirv00005772mPavirv00010929m
Pavirv00022059mPavirv00056667m
Phaseolus vulgarisPhvul.008G291000.1
Populus trichocarpaPotri.016G019400.1
Prunus persicappa016262m
Ricinus communis30106.m000653
Setaria italicaSi009868mSi019167mSi033416m
Sorghum bicolorSb04g026870.1Sb06g023060.1Sb02g022240.1
Thellungiella halophilaThhalv10020711m
Vitis viniferaGSVIVT01010098001
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny