y PlantCAZyme

CAZyme Information

Basic Information
SpeciesBrachypodium distachyon
Cazyme IDBradi3g51207.1
FamilyCE16
Protein PropertiesLength: 367 Molecular Weight: 38943.5 Isoelectric Point: 9.6819
ChromosomeChromosome/Scaffold: 3 Start: 52304424 End: 52306924
DescriptionGDSL-like Lipase/Acylhydrolase superfamily protein
View CDS
External Links
NCBI Taxonomy
Plaza
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
CE16363452.5e-21
  FGDSTADVGSNNYLPGSAVPRANFPHNGIDFPTSRATGRFSNGYNGIDFLALNMGFKRSPPPFLSVANKTNKQISQGLLGVNFASAGSGILDTTGDSIVA
  MSKQVEQFATLRCNISARISREAADDVLSRSLFLISTGGNDIFAFFSANSTPTAAQKQLFTANLVSLYVNHSKALYALGARKFAVIDVPPIGCCPYPRSL
  HPLGACIDVLNELTRGLNKGVKDAMHGLSVTLSGFKYSIGSSHAVVQNIMKHPQRLGFKEVTTACCGSGRFNGKSGCTPNATLCDNRHEYLFWDLLHPTH
  ATSKLAAAAI
Full Sequence
Protein Sequence     Length: 367     Download
MATAVTPARH ALRLLALAAV WVSVAAAAKV PALYVFGDST ADVGSNNYLP GSAVPRANFP    60
HNGIDFPTSR ATGRFSNGYN GIDFLALNMG FKRSPPPFLS VANKTNKQIS QGLLGVNFAS    120
AGSGILDTTG DSIVAMSKQV EQFATLRCNI SARISREAAD DVLSRSLFLI STGGNDIFAF    180
FSANSTPTAA QKQLFTANLV SLYVNHSKAL YALGARKFAV IDVPPIGCCP YPRSLHPLGA    240
CIDVLNELTR GLNKGVKDAM HGLSVTLSGF KYSIGSSHAV VQNIMKHPQR LGFKEVTTAC    300
CGSGRFNGKS GCTPNATLCD NRHEYLFWDL LHPTHATSKL AAAAIYNGSL RFAAPVNFRQ    360
LVEDLS*                                                              420
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
cd01847Triacylglycerol_lipase_like6.0e-1136347321+
COG3240COG32402.0e-1236356333+
cd01846fatty_acyltransferase_like5.0e-2836347322+
PLN03156PLN031569.0e-5636347321+
cd01837SGNH_plant_lipase_like4.0e-11536349319+
Gene Ontology
GO TermDescription
GO:0006629lipid metabolic process
GO:0016788hydrolase activity, acting on ester bonds
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankACG36192.102536426368GSDL-motif lipase [Zea mays]
GenBankACG47178.10893641278GSDL-motif lipase [Zea mays]
GenBankEEC73753.102936425360hypothetical protein OsI_08409 [Oryza sativa Indica Group]
RefSeqNP_001047688.102936425360Os02g0669000 [Oryza sativa (japonica cultivar-group)]
RefSeqNP_001148614.102636428369LOC100282230 [Zea mays]
Metabolic Pathways
Pathway NameReactionECProtein Name
triacylglycerol degradationTRIACYLGLYCEROL-LIPASE-RXNEC-3.1.1.3triacylglycerol lipase
Transmembrane Domains
StartEnd
1335
Signal Peptide
Cleavage Site
27
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
CJ6878622281343610
EE158626260362920
CK0721372141173300
HO852044331363640
FL833854222362570
Orthologous Group
SpeciesID
Arabidopsis lyrata314703476244337558337560910689
493878478837897686474533
Arabidopsis thalianaAT1G53920.1AT1G53940.1AT5G40990.1AT3G14225.1AT1G53990.1
AT1G71120.1AT1G54030.1
Brassica rapaBra030917Bra027356Bra014375Bra030916Bra027357
Bra037955Bra014374
Carica papayaevm.model.supercontig_25.181evm.model.supercontig_25.180
Capsella rubellaCarubv10009398mCarubv10010877mCarubv10007566mCarubv10012268mCarubv10003084m
Carubv10011675mCarubv10013917mCarubv10013827m
Citrus clementinaCiclev10010427mCiclev10025893mCiclev10027152mCiclev10025847mCiclev10026201m
Ciclev10018082m
Citrus sinensisorange1.1g048340morange1.1g016962morange1.1g040921morange1.1g039308morange1.1g017564m
orange1.1g045703m
Cucumis sativusCucsa.250410.1Cucsa.250420.1Cucsa.302790.1Cucsa.250430.1Cucsa.149300.1
Cucsa.359910.1Cucsa.359900.1Cucsa.149310.1Cucsa.149320.1
Eucalyptus grandisEucgr.C00766.1Eucgr.I02150.1Eucgr.L00840.1Eucgr.I02145.1Eucgr.J02601.1
Eucgr.I02148.1Eucgr.L00839.1Eucgr.L00835.1Eucgr.I02153.1Eucgr.I02146.1
Eucgr.I02141.1Eucgr.I02142.1
Fragaria vescamrna05441.1-v1.0-hybridmrna12948.1-v1.0-hybridmrna05444.1-v1.0-hybridmrna05442.1-v1.0-hybridmrna05440.1-v1.0-hybrid
mrna05439.1-v1.0-hybridmrna05435.1-v1.0-hybridmrna05432.1-v1.0-hybridmrna05424.1-v1.0-hybridmrna05422.1-v1.0-hybrid
mrna05427.1-v1.0-hybrid
Glycine maxGlyma03g42460.1Glyma19g23446.1Glyma19g45230.1Glyma15g20230.2Glyma07g04940.1
Glyma16g01490.1Glyma09g08640.1Glyma15g20240.2Glyma15g41850.1Glyma07g04930.1
Glyma15g41840.1
Gossypium raimondiiGorai.009G147000.1Gorai.009G146900.1Gorai.009G147100.1Gorai.009G050000.1Gorai.002G012900.1
Gorai.009G050000.2
Linum usitatissimumLus10013185Lus10037447
Malus domesticaMDP0000269753MDP0000304808MDP0000244607MDP0000309125MDP0000258269
MDP0000377058MDP0000219600MDP0000305029MDP0000211252MDP0000311221
MDP0000249059MDP0000476508
Manihot esculentacassava4.1_009415mcassava4.1_025013mcassava4.1_009903mcassava4.1_027743mcassava4.1_025020m
cassava4.1_034345mcassava4.1_013905m
Medicago truncatulaMedtr8g022810.1Medtr6g031090.1Medtr6g031210.1Medtr6g031240.1Medtr6g031230.1
Medtr8g022790.1Medtr8g074580.1
Mimulus guttatusmgv1a012459m
Oryza sativaLOC_Os02g44860.1
Panicum virgatumPavirv00028881mPavirv00042733m
Physcomitrella patensPp1s138_71V6.1Pp1s213_25V6.1
Phaseolus vulgarisPhvul.009G262300.1Phvul.009G223500.1Phvul.010G021000.1
Picea abiesMA_533908g0010MA_102522g0010MA_4268g0010MA_10432722g0010MA_58652g0010
MA_17845g0010MA_244382g0010MA_317926g0010
Populus trichocarpaPotri.007G133500.2Potri.007G133500.3Potri.007G133500.6Potri.007G133700.1Potri.004G084200.1
Potri.003G071500.1Potri.007G133500.4Potri.003G071400.1Potri.007G133700.2Potri.017G134600.2
Potri.013G065100.1Potri.T095100.1Potri.017G134600.1Potri.004G084500.1Potri.004G084400.1
Potri.T143300.1Potri.018G063900.1Potri.007G133500.1Potri.007G133500.5
Prunus persicappa026827mppa023400mppa024154mppa020514mppa007226m
ppa026665mppa027180mppa022327mppa021518m
Ricinus communis29739.m00368927585.m00015128885.m00011027585.m00014827585.m000152
28565.m00032428885.m00010827585.m00014928686.m00004428885.m000109
27585.m00015028885.m00112
Setaria italicaSi008507mSi017497m
Selaginella moellendorffii6571711378111390941374534524
404807453384081136572576816
755368082870987402765421623
40276940811540277155751424706
Thellungiella halophilaThhalv10011561mThhalv10011584mThhalv10020963mThhalv10021005m
Vitis viniferaGSVIVT01015012001GSVIVT01016687001GSVIVT01016689001GSVIVT01016690001GSVIVT01016685001
GSVIVT01016686001GSVIVT01016692001GSVIVT01016691001.530.765GSVIVT01016691001.530.765GSVIVT01016691001.112.342
GSVIVT01016691001.112.342
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)