y PlantCAZyme

CAZyme Information

Basic Information
SpeciesBrachypodium distachyon
Cazyme IDBradi3g52040.1
FamilyGT57
Protein PropertiesLength: 515 Molecular Weight: 58064.8 Isoelectric Point: 9.1591
ChromosomeChromosome/Scaffold: 3 Start: 53028654 End: 53032208
DescriptionALG6, ALG8 glycosyltransferase family
View CDS
External Links
NCBI Taxonomy
Plaza
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GT57195060
  ATCVKLLLVPTYRSTDFDVHRYWLALTHALPARQWYVDASSEWTLDYPPFFAYFSRLLSLAAPLVDASLVSLPVPAAPHSSPYLLYLRLTVAFSDLLLLA
  SVLLLAVDARRRQRPFLALVLVLWSPALLAVDHVHFQYNGFLMGLLLLSLHFLEQGKDLAGGVAFAALLCSKHLFLVAAPVYFVYLFRHYCCGRGVVRGL
  GRLVLMGAGVVAIFAMAFAPFMYYGQMQQLFSRLFPFGRGLFHAYWAPNFWVFYIILDKILAYVLRRLGFNIEIPEASFTRGLVGDSSPFAVLPKVTPIT
  TFLLVILAMTPCLVKAFSNPQPKHIIRWVSYACSCGFMFGWHVHEKASLHFTIPLALIAMDSLDDVRHYFLLSIVSCYSLFPLLFENQEYPIKVLLLLTY
  STLMWVGFSSHLSANSAREEKKANASGIIVKQKFTGWISLWYLSGVFAIELWSQVFHNYVFGDRLPFLPLMMVSVYCGVGMMYSWMWQ
Full Sequence
Protein Sequence     Length: 515     Download
MAAAAASPST ATVWAFAAAT CVKLLLVPTY RSTDFDVHRY WLALTHALPA RQWYVDASSE    60
WTLDYPPFFA YFSRLLSLAA PLVDASLVSL PVPAAPHSSP YLLYLRLTVA FSDLLLLASV    120
LLLAVDARRR QRPFLALVLV LWSPALLAVD HVHFQYNGFL MGLLLLSLHF LEQGKDLAGG    180
VAFAALLCSK HLFLVAAPVY FVYLFRHYCC GRGVVRGLGR LVLMGAGVVA IFAMAFAPFM    240
YYGQMQQLFS RLFPFGRGLF HAYWAPNFWV FYIILDKILA YVLRRLGFNI EIPEASFTRG    300
LVGDSSPFAV LPKVTPITTF LLVILAMTPC LVKAFSNPQP KHIIRWVSYA CSCGFMFGWH    360
VHEKASLHFT IPLALIAMDS LDDVRHYFLL SIVSCYSLFP LLFENQEYPI KVLLLLTYST    420
LMWVGFSSHL SANSAREEKK ANASGIIVKQ KFTGWISLWY LSGVFAIELW SQVFHNYVFG    480
DRLPFLPLMM VSVYCGVGMM YSWMWQLLWI VRHT*                               540
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
pfam03155Alg6_Alg84.0e-8418505502+
Gene Ontology
GO TermDescription
GO:0005789endoplasmic reticulum membrane
GO:0016758transferase activity, transferring hexosyl groups
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
DDBJBAD07664.102051321518putative glucosyltransferase [Oryza sativa Japonica Group]
GenBankEAY87118.102051321518hypothetical protein OsI_08520 [Oryza sativa Indica Group]
RefSeqNP_001047779.102051318515Os02g0688500 [Oryza sativa (japonica cultivar-group)]
RefSeqNP_181994.5015071501transferase, transferring glycosyl groups / transferase, transferring hexosyl groups [Arabidopsis thaliana]
RefSeqXP_002454458.102051423517hypothetical protein SORBIDRAFT_04g031440 [Sorghum bicolor]
Metabolic Pathways
Pathway NameReactionECProtein Name
dolichyl-diphosphooligosaccharide biosynthesisRXN-5471EC-2.4.1.265Dol-P-Glc:Glc1Man9GlcNAc2-PP-Dol α-1,3-glucosyltransferase
Transmembrane Domains
StartEnd
1330
103125
132154
183205
218240
260282
386403
413432
452474
489511
Signal Peptide
Cleavage Site
19
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
GT0409202852315150
GT8126062222945150
GT8126052401764150
GT0451142002524510
GT045114674495150
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_007_00352.1
Arabidopsis lyrata903892
Arabidopsis thalianaAT2G44660.1
Brassica rapaBra004854
Carica papayaevm.model.supercontig_50.144
Capsella rubellaCarubv10023047m
Chlamydomonas reinhardtiiCre09.g414250.t1.3.19.125Cre09.g414250.t1.3.178.595Cre09.g414250.t1.3.178.595Cre09.g414250.t1.3.19.125
Citrus clementinaCiclev10014906m
Citrus sinensisorange1.1g019776morange1.1g026008morange1.1g009885m
Cucumis sativusCucsa.362250.1
Eucalyptus grandisEucgr.E01703.1
Fragaria vescamrna03056.1-v1.0-hybrid
Glycine maxGlyma08g10420.1Glyma05g27431.2Glyma05g27431.1
Gossypium raimondiiGorai.003G062300.1
Linum usitatissimumLus10043344Lus10019495
Malus domesticaMDP0000238047
Manihot esculentacassava4.1_005358m
Medicago truncatulaMedtr5g077540.1
Mimulus guttatusmgv1a004526m
Oryza sativaLOC_Os02g46320.1
Panicum virgatumPavirv00056060mPavirv00065643m
Physcomitrella patensPp1s34_140V6.1
Phaseolus vulgarisPhvul.007G221000.2Phvul.007G221000.1
Picea abiesMA_10429975g0010MA_7890741g0010
Populus trichocarpaPotri.014G053200.1
Prunus persicappa016151mppa004246m
Ricinus communis29634.m002078.26.16329634.m002078.26.16329634.m002078.164.48529634.m002078.164.485
Setaria italicaSi016919m
Selaginella moellendorffii45405.175.35645405.175.356
Sorghum bicolorSb04g031440.1
Thellungiella halophilaThhalv10001410m
Vitis viniferaGSVIVT01018341001
Volvox carteriVocar20011939m
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny