y PlantCAZyme

CAZyme Information

Basic Information
SpeciesBrachypodium distachyon
Cazyme IDBradi3g54230.1
FamilyGT16
Protein PropertiesLength: 445 Molecular Weight: 49914 Isoelectric Point: 9.3818
ChromosomeChromosome/Scaffold: 3 Start: 54713406 End: 54715077
Descriptionbeta-1,2-N-acetylglucosaminyltransferase II
View CDS
External Links
NCBI Taxonomy
Plaza
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GT16924290
  LASRNALPPRNAARFPRLPDGHLKVVLYVHNRPRYLRLVVDSLSRVDGISEALLIVSHDGYFPEMDEIVQGISFCQVKQIFAPYSPHLFPDAFPGVSPGD
  CRDKDKATEKRCRGDPDQYGNHRSPRIVSLKHHWWWMMNTVWDGLEETRDFDGHILFIEEDHYIFPNAYRDAQLLVDLKPKKCPQCYAVNLAPSDVKARG
  EGWESLIAEKMGNIGYAFNRTVWRKIHAKAKQFCTFDEYNWDITMWATVYPSFGAPVYSLRGPRRSAAHFGKCGLHQGQDSSNVCVDNGVGAVELDAIDK
  VPNIKADWPVHIIRKQQGYQAGFKGWGGWGDRRDQELC
Full Sequence
Protein Sequence     Length: 445     Download
MAATTSSSLH PHHRARLRSR AGPLLAVVVV SVLALTGLLR ASRRDGAAAD LAPLSAARAR    60
EASNRTIAQR KILLDPAFTP RLPRHSALSL SLASRNALPP RNAARFPRLP DGHLKVVLYV    120
HNRPRYLRLV VDSLSRVDGI SEALLIVSHD GYFPEMDEIV QGISFCQVKQ IFAPYSPHLF    180
PDAFPGVSPG DCRDKDKATE KRCRGDPDQY GNHRSPRIVS LKHHWWWMMN TVWDGLEETR    240
DFDGHILFIE EDHYIFPNAY RDAQLLVDLK PKKCPQCYAV NLAPSDVKAR GEGWESLIAE    300
KMGNIGYAFN RTVWRKIHAK AKQFCTFDEY NWDITMWATV YPSFGAPVYS LRGPRRSAAH    360
FGKCGLHQGQ DSSNVCVDNG VGAVELDAID KVPNIKADWP VHIIRKQQGY QAGFKGWGGW    420
GDRRDQELCL SFAYMYHVKD PSPT*                                          480
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
pfam05060MGAT20101429345+
Gene Ontology
GO TermDescription
GO:0005795Golgi stack
GO:0008455alpha-1,6-mannosylglycoprotein 2-beta-N-acetylglucosaminyltransferase activity
GO:0009312oligosaccharide biosynthetic process
GO:0016021integral to membrane
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
DDBJBAD36053.1034422436putative beta-1,2-N- acetylglucosaminyltransferase II [Oryza sativa Japonica Group]
DDBJBAF10314.2034422438Os02g0798100 [Oryza sativa Japonica Group]
GenBankEAY87874.1034422439hypothetical protein OsI_09295 [Oryza sativa Indica Group]
RefSeqNP_001048400.1034212415Os02g0798100 [Oryza sativa (japonica cultivar-group)]
RefSeqXP_002452985.101044212451hypothetical protein SORBIDRAFT_04g036090 [Sorghum bicolor]
Transmembrane Domains
StartEnd
2139
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
EB1635512521944450
CB619354276713460
CO4744092741073800
FE7038942671013670
FQ4245252711334030
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_110_00024.1
Arabidopsis lyrata480143
Arabidopsis thalianaAT2G05320.1
Brassica rapaBra013178
Carica papayaevm.model.supercontig_136.28
Capsella rubellaCarubv10013752m
Citrus clementinaCiclev10015287m
Citrus sinensisorange1.1g048409m
Cucumis sativusCucsa.100290.1
Eucalyptus grandisEucgr.H00879.1
Fragaria vescamrna15520.1-v1.0-hybrid
Glycine maxGlyma10g25781.1Glyma20g20280.2
Gossypium raimondiiGorai.007G166200.1Gorai.001G221700.1
Linum usitatissimumLus10001174Lus10001748
Malus domesticaMDP0000230423.81.277MDP0000762447MDP0000230423.81.277MDP0000230423.283.396MDP0000230423.283.396
Manihot esculentacassava4.1_007960m
Mimulus guttatusmgv1a026909mmgv1a018673m
Oryza sativaLOC_Os02g55470.1
Panicum virgatumPavirv00058015mPavirv00014783m
Physcomitrella patensPp1s8_84V6.1Pp1s372_1V6.1
Phaseolus vulgarisPhvul.007G239000.1
Picea abiesMA_10427700g0020MA_10427700g0010
Populus trichocarpaPotri.014G167200.1
Prunus persicappa007646m
Ricinus communis28859.m000321
Setaria italicaSi017206m
Selaginella moellendorffii80130
Sorghum bicolorSb04g036090.1
Thellungiella halophilaThhalv10002538m
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny