y PlantCAZyme

CAZyme Information

Basic Information
SpeciesBrachypodium distachyon
Cazyme IDBradi3g54387.1
FamilyGT28
Protein PropertiesLength: 505 Molecular Weight: 55707.1 Isoelectric Point: 7.4776
ChromosomeChromosome/Scaffold: 3 Start: 54887705 End: 54892314
Descriptionmonogalactosyldiacylglycerol synthase 2
View CDS
External Links
NCBI Taxonomy
Plaza
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GT283044622.1e-30
  VLLMGGGEGMGPVKKTAKALGEALFDKELGKPIGQLVVICGRNKTLSSSLQSLEWKMPVKIRGFETQMEKWMGACDCIITKAGPGTIAEALIRGLPIILN
  DFIPGQEVGNVPYVVDNGAGVFSKSPKETAALVASWFGPGLEERKRMSENALKLAQPEA
Full Sequence
Protein Sequence     Length: 505     Download
MAASMASPRG RSIRETVLES VAAYQQQQRM RRRFRKSLSY AGELSSAGRA GGGDGPSSSS    60
SASVSSLCGP EEDDEPFWEE EEGTVELVQL GANRAKNVLI LMSDTGGGHR ASAEAIKDAF    120
RIEFGDDYRV FVKDLCKDHA GWPLNNMESS YKFMVKHVQL WKVAFHTTSP RWVHCLYLGS    180
LASFYAKKVE AGLKKYKPDI IISVHPLMQH IPLWVLKWQG LQNRVVFTTV ITDLNTCHPT    240
WFHADVNRCY CPSEEVAKRA EMDELKPSQI RVFGLPIRPS FCRAVLVKDD LRRELEMDPE    300
LPAVLLMGGG EGMGPVKKTA KALGEALFDK ELGKPIGQLV VICGRNKTLS SSLQSLEWKM    360
PVKIRGFETQ MEKWMGACDC IITKAGPGTI AEALIRGLPI ILNDFIPGQE VGNVPYVVDN    420
GAGVFSKSPK ETAALVASWF GPGLEERKRM SENALKLAQP EAVFDIVRDI HALSQEQGVI    480
SQISSSLTSS FFIQSPETTP IQLM*                                          540
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
COG0707MurG2.0e-2599467388+
PRK13608PRK136082.0e-3196470395+
PRK13609PRK136094.0e-4493475394+
pfam06925MGDG_synth2.0e-69109277169+
PLN02605PLN02605098477382+
Gene Ontology
GO TermDescription
GO:0005975carbohydrate metabolic process
GO:0009247glycolipid biosynthetic process
GO:0016758transferase activity, transferring hexosyl groups
GO:0030246carbohydrate binding
GO:0030259lipid glycosylation
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
DDBJBAC77638.101475041358putative monogalactosyldiacylglycerol synthase [Oryza sativa Indica Group]
GenBankEAY87902.10850414508hypothetical protein OsI_09321 [Oryza sativa Indica Group]
RefSeqNP_001147778.1015041501LOC100281388 [Zea mays]
Swiss-ProtQ0DWQ10850414508MGDG3_ORYSJ RecName: Full=Probable monogalactosyldiacylglycerol synthase 3, chloroplastic; Short=OsMGD3; Flags: Precursor
RefSeqXP_002452992.1015041501hypothetical protein SORBIDRAFT_04g036240 [Sorghum bicolor]
Metabolic Pathways
Pathway NameReactionECProtein Name
glycolipid biosynthesis2.4.1.46-RXNEC-2.4.1.46monogalactosyldiacylglycerol synthase
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
GO8450523121935040
CJ6720792751344080
DR7969072701003690
DT3392792961564510
GT8107122342094420
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_016_00340.4Aquca_016_00340.1Aquca_048_00001.3Aquca_048_00001.1Aquca_016_00340.2
Arabidopsis lyrata899522913288488950
Arabidopsis thalianaAT2G11810.1AT4G31780.2AT5G20410.1AT4G31780.1
Brachypodium distachyonBradi4g30600.1Bradi3g20020.1
Brassica rapaBra023984Bra011297Bra037199Bra020104
Carica papayaevm.model.supercontig_148.42evm.model.supercontig_277.14
Capsella rubellaCarubv10006327mCarubv10013637mCarubv10000862m
Chlamydomonas reinhardtiig14367.t1
Citrus clementinaCiclev10007936mCiclev10007956mCiclev10008213mCiclev10008083m
Citrus sinensisorange1.1g036427morange1.1g012492m
Cucumis sativusCucsa.162930.1Cucsa.132470.1
Eucalyptus grandisEucgr.C04035.1Eucgr.C00320.1Eucgr.C00495.1Eucgr.C04379.1Eucgr.C04035.2
Fragaria vescamrna14993.1-v1.0-hybridmrna31719.1-v1.0-hybridmrna30765.1-v1.0-hybrid
Glycine maxGlyma17g33780.1Glyma14g12120.1Glyma13g23150.1Glyma17g11720.1
Gossypium raimondiiGorai.010G119700.2Gorai.001G039100.1Gorai.010G119700.1Gorai.013G236200.1Gorai.009G014700.1
Gorai.009G014700.3
Linum usitatissimumLus10026895Lus10003418Lus10016359Lus10008048
Malus domesticaMDP0000135680MDP0000244574MDP0000214451MDP0000829982MDP0000305295
Manihot esculentacassava4.1_005396mcassava4.1_005397mcassava4.1_006812m
Medicago truncatulaMedtr4g115920.2Medtr4g115920.1
Mimulus guttatusmgv1a004593mmgv1a006191m
Oryza sativaLOC_Os09g25580.1LOC_Os02g55910.2LOC_Os02g55910.1LOC_Os08g20420.1LOC_Os08g20420.2
Panicum virgatumPavirv00042978mPavirv00044523mPavirv00010348mPavirv00051656mPavirv00029899m
Pavirv00008414mPavirv00051657m
Physcomitrella patensPp1s33_287V6.1Pp1s20_66V6.1
Phaseolus vulgarisPhvul.001G042600.1Phvul.003G171300.1
Picea abiesMA_5461g0010
Populus trichocarpaPotri.006G266500.1Potri.018G016600.1Potri.006G063300.3Potri.006G063300.2Potri.006G063300.1
Potri.018G123000.1Potri.006G266500.2
Prunus persicappa003927mppa006453m
Ricinus communis29848.m00450927394.m000347
Setaria italicaSi029462mSi016983mSi015030m
Selaginella moellendorffii271007
Sorghum bicolorSb02g025070.1Sb04g036240.1Sb07g027910.1
Thellungiella halophilaThhalv10024883mThhalv10022676mThhalv10013431m
Vitis viniferaGSVIVT01035995001GSVIVT01012838001
Volvox carteriVocar20009507m
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)