y PlantCAZyme

CAZyme Information

Basic Information
SpeciesBrachypodium distachyon
Cazyme IDBradi3g56870.1
FamilyGH9
Protein PropertiesLength: 307 Molecular Weight: 33107 Isoelectric Point: 5.0464
ChromosomeChromosome/Scaffold: 3 Start: 56607029 End: 56609556
Descriptionglycosyl hydrolase 9B6
View CDS
External Links
NCBI Taxonomy
Plaza
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GH921133.2e-30
  LRRVAKRQVDYILGDNPLRMSYMVGYGLTFPRWIHRRGGSSVPSVADHPARVECKAGTAYYTSNGPNPNLLVGAVVGGPNDACSDAYAHARAVFQQSEPT
  TYINAALIGLLA
Full Sequence
Protein Sequence     Length: 307     Download
MLRRVAKRQV DYILGDNPLR MSYMVGYGLT FPRWIHRRGG SSVPSVADHP ARVECKAGTA    60
YYTSNGPNPN LLVGAVVGGP NDACSDAYAH ARAVFQQSEP TTYINAALIG LLAHFSACPD    120
PAMASALPEN TLQPVYQTRH LRCRQVHGRI QRCKLQRPAK ARRGRRPART QTRAATVADE    180
FALVVDLVLL LDDDAKREEE DKEERGGGDG VGAMEEGERD GDVEEAEKRG AAGLLPAAAA    240
RVGHDPDGVD EDDGDGRSEP GDEEDERLGV VAVEGEVELR VDGAAEADES LRILSMIPRL    300
SGKFLT*                                                              360
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
pfam00759Glyco_hydro_95.0e-332113112+
PLN02613PLN026131.0e-382113113+
PLN02266PLN022665.0e-452116115+
PLN03009PLN030091.0e-462122121+
PLN02308PLN023081.0e-601122122+
Gene Ontology
GO TermDescription
GO:0004553hydrolase activity, hydrolyzing O-glycosyl compounds
GO:0005975carbohydrate metabolic process
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankACN25509.102122288406unknown [Zea mays]
GenBankACN26434.102122222340unknown [Zea mays]
GenBankEAZ00403.102127372495hypothetical protein OsI_22418 [Oryza sativa Indica Group]
RefSeqNP_001131617.202122383501hypothetical protein LOC100192969 [Zea mays]
RefSeqXP_002454331.102122381499hypothetical protein SORBIDRAFT_04g028790 [Sorghum bicolor]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB1ia7_A0.00000000012113329424A Chain A, Structure And Activity Of A Flavonoid 3-O Glucosyltransferase Reveals The Basis For Plant Natural Product Modification
PDB1ia6_A0.00000000012113329424A Chain A, Crystal Structure Of The Cellulase Cel9m Of C. Cellulolyticum
PDB4tf4_B0.0000025113345438A Chain A, Crystal Structure Of The Cellulase Cel9m Of C. Cellulolyticum
PDB4tf4_A0.0000025113345438A Chain A, Crystal Structure Of The Cellulase Cel9m Of C. Cellulolyticum
PDB3tf4_B0.0000025113345438A Chain A, Crystal Structure Of The Cellulase Cel9m Of C. Cellulolyticum
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
CA12466412421250
GR35322712121220
DR95852912121220
CO52789312121220
EC88960212121220
Orthologous Group
SpeciesID
Citrus sinensisorange1.1g019436m.12.195orange1.1g045046m.271.412orange1.1g045046m.271.412orange1.1g043973m
Fragaria vescamrna21630.1-v1.0-hybrid
Linum usitatissimumLus10025880.184.443Lus10025880.184.443Lus10010307.382.492Lus10010307.382.492
Malus domesticaMDP0000322418MDP0000151410
Medicago truncatulaMedtr4g037140.1
Panicum virgatumPavirv00065976m
Picea abiesMA_107238g0010.352.456MA_107238g0010.352.456MA_10430095g0010.237.398MA_10430095g0010.237.398
Ricinus communis30131.m007125.321.42330131.m007125.321.42328865.m000016
Vitis viniferaGSVIVT01019379001
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny