y PlantCAZyme

CAZyme Information

Basic Information
SpeciesBrachypodium distachyon
Cazyme IDBradi3g58040.1
FamilyGT37
Protein PropertiesLength: 499 Molecular Weight: 56887.9 Isoelectric Point: 8.076
ChromosomeChromosome/Scaffold: 3 Start: 57617756 End: 57619580
Descriptionfucosyltransferase 1
View CDS
External Links
NCBI Taxonomy
Plaza
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GT3764660
  ADDLSPSAQIEYDKLLGGLLIEGFDERSCRSRYQFARYHRNAARVPSAYLIERLRRQEALQKKCGPGTKSYNKALKQLSSGQSINTTDCNYLFLIIHAGL
  GNRMLEITSAFLYALLTDRILLVDRYKEIADIFCEPFPETSWLISSDFPLNYDEFTQSSPESYGNMLREKVIGGNTYRSLVGARPPFVYLYLDGNYGFHD
  KLFYCEDDQQFLKGVPWLIMRTDMYFVPSLFLIPSYQDELSRLFPEKDTVFHHLARYLFHPTNDIWYSVTAYYKAYLAKADKRVGVQIRIYETKGILQRN
  GPFPHILEQILSCAQNEKLLPEIGATAEAAAVTAGKNQTIAVLTTSLSSWYSDQIRKRYSEHQTVDGTTVKVYQPSHEEYQKSKNKKHNMKALAEIYLLS
  MTDVLITSGFSTFGYAAQGLAGKTPWILFRSTNHVAPDPACGRGMSIEPCFHNAPFYDCKA
Full Sequence
Protein Sequence     Length: 499     Download
MKDDIADDLS PSAQIEYDKL LGGLLIEGFD ERSCRSRYQF ARYHRNAARV PSAYLIERLR    60
RQEALQKKCG PGTKSYNKAL KQLSSGQSIN TTDCNYLFLI IHAGLGNRML EITSAFLYAL    120
LTDRILLVDR YKEIADIFCE PFPETSWLIS SDFPLNYDEF TQSSPESYGN MLREKVIGGN    180
TYRSLVGARP PFVYLYLDGN YGFHDKLFYC EDDQQFLKGV PWLIMRTDMY FVPSLFLIPS    240
YQDELSRLFP EKDTVFHHLA RYLFHPTNDI WYSVTAYYKA YLAKADKRVG VQIRIYETKG    300
ILQRNGPFPH ILEQILSCAQ NEKLLPEIGA TAEAAAVTAG KNQTIAVLTT SLSSWYSDQI    360
RKRYSEHQTV DGTTVKVYQP SHEEYQKSKN KKHNMKALAE IYLLSMTDVL ITSGFSTFGY    420
AAQGLAGKTP WILFRSTNHV APDPACGRGM SIEPCFHNAP FYDCKAKRDN VDLGKVVPYV    480
RRCEDVSWGL KIVNQTQL*                                                 540
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
cd11548NodZ_like0.00237842548+
cd11548NodZ_like0.00039812934+
pfam03254XG_FTase04466464+
Gene Ontology
GO TermDescription
GO:0008107galactoside 2-alpha-L-fucosyltransferase activity
GO:0016020membrane
GO:0042546cell wall biogenesis
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankEEC74050.10149735532hypothetical protein OsI_09046 [Oryza sativa Indica Group]
GenBankEEE57854.10149135526hypothetical protein OsJ_08490 [Oryza sativa Japonica Group]
RefSeqNP_001048212.10149735532Os02g0763900 [Oryza sativa (japonica cultivar-group)]
RefSeqNP_001142272.109498103604hypothetical protein LOC100274441 [Zea mays]
RefSeqXP_002452877.10149855558hypothetical protein SORBIDRAFT_04g034100 [Sorghum bicolor]
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
CJ718913259152720
CB66102627312720
CJ7067812731904620
FL838196249292750
GO7947582572434990
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_002_00710.1Aquca_002_00674.2Aquca_002_00674.1Aquca_002_00675.1Aquca_002_00677.1
Aquca_024_00009.1Aquca_006_00124.1Aquca_002_00676.1.65.313Aquca_002_00676.1.65.313Aquca_002_00676.1.313.480
Aquca_002_00676.1.313.480
Arabidopsis lyrata484227312409.55.508312409.55.508484226879690
874761480406877549879689
Arabidopsis thalianaAT2G03220.1AT1G14100.1AT2G03210.1AT1G14070.1AT1G14080.1
AT2G15370.1AT2G15390.2AT2G15390.1AT1G74420.2AT1G74420.1
AT2G15350.1AT1G14110.1.33.335AT1G14110.1.33.335AT1G14110.1.336.446AT1G14110.1.336.446
Brachypodium distachyonBradi3g58030.1Bradi1g46010.1Bradi1g46020.1Bradi4g32407.1Bradi2g40470.1
Bradi3g58067.1Bradi1g46050.1Bradi1g46030.1Bradi5g11770.1Bradi1g46037.1
Bradi4g32160.1Bradi1g46002.1Bradi4g13697.1Bradi3g10230.1Bradi3g58050.1
Brassica rapaBra024785Bra019679Bra019680Bra024786Bra016712
Bra016709Bra026858Bra026859Bra019685Bra016711
Bra015217Bra026861.214.659Bra026861.214.659Bra039838Bra019681
Bra019683.173.573Bra019683.173.573Bra026860Bra003802.296.542Bra003802.296.542
Bra016710.192.381Bra016710.192.381Bra016710.35.189Bra016710.35.189Bra003802.141.280
Bra003802.141.280Bra026861.47.184Bra026861.47.184Bra019683.64.173Bra019683.64.173
Carica papayaevm.model.supercontig_341.1evm.model.supercontig_1.58evm.model.supercontig_57.37
Capsella rubellaCarubv10016945mCarubv10008772mCarubv10011805m.34.489Carubv10011805m.34.489Carubv10011805m.34.489
Carubv10016438mCarubv10019159mCarubv10013337mCarubv10008907mCarubv10011805m.506.770
Carubv10011805m.506.770Carubv10011805m.506.770Carubv10020557mCarubv10011805m.771.920Carubv10011805m.771.920
Carubv10011805m.771.920
Citrus clementinaCiclev10000822mCiclev10000784mCiclev10019479mCiclev10000769mCiclev10033742m.202.352
Ciclev10033742m.202.352Ciclev10033742m.82.202Ciclev10033742m.82.202Ciclev10003626m.196.297Ciclev10003626m.196.297
Citrus sinensisorange1.1g009398morange1.1g009137morange1.1g039620morange1.1g008917morange1.1g010030m
orange1.1g019688morange1.1g046759m.200.367orange1.1g046759m.200.367orange1.1g046759m.82.201orange1.1g046759m.82.201
Cucumis sativusCucsa.284850.1Cucsa.112900.1Cucsa.179880.1
Eucalyptus grandisEucgr.B03204.1Eucgr.B00531.2Eucgr.B00531.1
Fragaria vescamrna26047.1-v1.0-hybrid
Glycine maxGlyma06g21090.1Glyma04g33170.1Glyma05g00920.1Glyma13g44770.9Glyma13g44770.8
Glyma13g44770.7Glyma13g44770.6Glyma13g44770.5Glyma13g44770.4Glyma13g44770.11
Glyma13g44770.10Glyma08g23480.1Glyma13g44770.15Glyma13g44770.14Glyma13g44770.13
Glyma13g44770.12Glyma07g02550.2Glyma07g02540.2Glyma07g02540.1Glyma17g10980.1
Glyma13g44760.1Glyma08g23470.2
Gossypium raimondiiGorai.013G088600.1Gorai.001G072600.2Gorai.001G072600.1
Linum usitatissimumLus10036776Lus10008696Lus10041642Lus10041641Lus10029049
Lus10037152Lus10026128Lus10024076Lus10041644Lus10013549
Lus10012571Lus10041645Lus10008693Lus10026125Lus10008691
Lus10024077Lus10024079
Malus domesticaMDP0000230681MDP0000176324MDP0000529420MDP0000204702MDP0000668674
MDP0000300083
Manihot esculentacassava4.1_021940mcassava4.1_023646mcassava4.1_025117mcassava4.1_004330mcassava4.1_004355m
cassava4.1_004412mcassava4.1_004549mcassava4.1_004338m
Medicago truncatulaMedtr1g090430.1AC233556_13.1Medtr4g007220.1Medtr2g020730.1Medtr4g007380.1
Medtr4g007360.1
Mimulus guttatusmgv1a003737m
Oryza sativaLOC_Os02g52640.1LOC_Os02g52610.1LOC_Os02g52610.2LOC_Os06g10960.1LOC_Os02g52630.1
LOC_Os06g10950.1LOC_Os06g10970.1LOC_Os02g52560.1LOC_Os04g37640.1LOC_Os04g37650.1
LOC_Os06g10930.1LOC_Os02g52590.1LOC_Os06g10980.1LOC_Os06g10910.1LOC_Os09g28460.1
LOC_Os08g24750.1LOC_Os06g10920.1LOC_Os02g17534.1LOC_Os02g17600.1LOC_Os02g25630.1
Panicum virgatumPavirv00070548mPavirv00051908mPavirv00022554mPavirv00065240mPavirv00003029m
Pavirv00050380mPavirv00010182mPavirv00042819mPavirv00022553mPavirv00056797m
Pavirv00051909mPavirv00044824mPavirv00015944mPavirv00041002mPavirv00051213m
Pavirv00040276mPavirv00068125mPavirv00007429mPavirv00000679mPavirv00064479m
Pavirv00019978mPavirv00015945mPavirv00061706mPavirv00010181mPavirv00034186m
Pavirv00004957mPavirv00041951mPavirv00007564mPavirv00053047mPavirv00026147m.124.422
Pavirv00026147m.124.422Pavirv00026388m
Physcomitrella patensPp1s352_42V6.1Pp1s126_53V6.1Pp1s177_107V6.1Pp1s177_109V6.1Pp1s38_405V6.1
Pp1s28_329V6.1Pp1s92_101V6.1Pp1s52_48V6.1Pp1s75_26V6.1Pp1s115_139V6.1
Pp1s115_139V6.2Pp1s199_19V6.1.228.510Pp1s199_19V6.1.228.510Pp1s71_58V6.1Pp1s199_19V6.1.107.211
Pp1s199_19V6.1.107.211
Phaseolus vulgarisPhvul.009G185700.1Phvul.005G182600.1Phvul.010G162100.1Phvul.010G162000.1Phvul.010G161900.1
Phvul.010G161900.2Phvul.003G188900.1
Picea abiesMA_38751g0010MA_478295g0010MA_402760g0010
Populus trichocarpaPotri.001G034100.1Potri.003G191200.1Potri.003G191500.1Potri.003G191300.2Potri.001G033800.1
Potri.008G090000.1Potri.003G191300.1Potri.003G191300.3Potri.003G191300.4Potri.001G034000.1
Prunus persicappa003476mppa003874m
Ricinus communis28333.m00057928333.m00058129686.m00087429686.m00087629813.m001528
29686.m00087529686.m00087730138.m004050.273.51930138.m004050.273.51928333.m000580
30138.m004050.89.27530138.m004050.89.275
Setaria italicaSi019396mSi016945mSi008446mSi008440mSi016741m
Si006115mSi019763mSi007978mSi008778mSi019585m
Si008425mSi012369mSi012302mSi009710mSi007932m
Si031974mSi008742mSi029404mSi016775mSi029293m
Si017473m
Selaginella moellendorffii9176197987416793441628412985
444560430640.63.271430640.63.271430640.280.409430640.280.409
427741.233.362427741.233.362427741.63.183427741.63.183420100
Sorghum bicolorSb04g034120.1Sb04g034100.1Sb10g007140.1Sb04g034070.1Sb10g007120.1
Sb04g034110.1Sb04g034080.1Sb02g026640.1Sb04g010430.1Sb10g007110.1
Sb04g010420.1Sb06g018250.1Sb04g010630.1Sb10g007150.1Sb02g001790.1
Sb08g004580.1Sb02g001803.1Sb10g007130.1.70.296Sb10g007130.1.70.296Sb10g007130.1.329.513
Sb10g007130.1.329.513
Thellungiella halophilaThhalv10003931mThhalv10009330mThhalv10009872mThhalv10007297mThhalv10009357m
Thhalv10009946mThhalv10009405mThhalv10005557mThhalv10022636mThhalv10009670m
Thhalv10018409mThhalv10000629m
Vitis viniferaGSVIVT01003228001.70.337GSVIVT01003228001.70.337GSVIVT01007978001.81.321GSVIVT01007978001.81.321GSVIVT01007978001.323.487
GSVIVT01007978001.323.487GSVIVT01003228001.337.442GSVIVT01003228001.337.442
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)