y PlantCAZyme

CAZyme Information

Basic Information
SpeciesBrachypodium distachyon
Cazyme IDBradi3g59187.1
FamilyAA1
Protein PropertiesLength: 579 Molecular Weight: 64357.3 Isoelectric Point: 7.3778
ChromosomeChromosome/Scaffold: 3 Start: 58425721 End: 58428545
Descriptionlaccase 14
View CDS
External Links
NCBI Taxonomy
Plaza
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
AA1345650
  HNFYIKEANHPRLCKNKTILTVNGQFPGPTITARRGDVVIVNVYNQGNKNITIHWHGVDQPRNPWYDGPEFITQCPIQPGTNFTYRILLSDEEGTIWWHA
  HSDFDRATVHGAFVIHPKHGSFYPFKMPHKEIPIILGEWWKADVTHLLEESKRTGGEVNLSDANIINGQPGDFFPCSKDNIFKLPVQTGKTYLLRIINAG
  LTNDLFYGIAGHLLTIVGTDGRYTKPFTVKHIMISPGQTMDALLEADRAINGSSNGRYYMAARTFASNTALDFNNSTTTAILEYTDAPPSRRAGTPDFPN
  LPANLDMNAATEYTAQLRSLASKDHPVDVPMHVDHPMLITIAINVLPCAPNQTCDGPNGNRLAASLNNVSFQNPSIDILDAYYSSVNGVFEASFPNKPPF
  FFNFTDTVVPPELEVTKVGTKVKMLNYGDVVEVVFQDTTINGAETHPMHLHGFAFYVVGRGFGNYDKLKDPATYNLIDPPYQNTVTVPKAGWTAIRWRAT
  NPGVWFMHCHFDRHTVWGMNTVFIVKDGKTPD
Full Sequence
Protein Sequence     Length: 579     Download
MVGVTKITMM LWVLGVVFTF GAAAVGLAEA NNVHNFYIKE ANHPRLCKNK TILTVNGQFP    60
GPTITARRGD VVIVNVYNQG NKNITIHWHG VDQPRNPWYD GPEFITQCPI QPGTNFTYRI    120
LLSDEEGTIW WHAHSDFDRA TVHGAFVIHP KHGSFYPFKM PHKEIPIILG EWWKADVTHL    180
LEESKRTGGE VNLSDANIIN GQPGDFFPCS KDNIFKLPVQ TGKTYLLRII NAGLTNDLFY    240
GIAGHLLTIV GTDGRYTKPF TVKHIMISPG QTMDALLEAD RAINGSSNGR YYMAARTFAS    300
NTALDFNNST TTAILEYTDA PPSRRAGTPD FPNLPANLDM NAATEYTAQL RSLASKDHPV    360
DVPMHVDHPM LITIAINVLP CAPNQTCDGP NGNRLAASLN NVSFQNPSID ILDAYYSSVN    420
GVFEASFPNK PPFFFNFTDT VVPPELEVTK VGTKVKMLNY GDVVEVVFQD TTINGAETHP    480
MHLHGFAFYV VGRGFGNYDK LKDPATYNLI DPPYQNTVTV PKAGWTAIRW RATNPGVWFM    540
HCHFDRHTVW GMNTVFIVKD GKTPDTKMMK RPPSMPRC*                           600
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
TIGR03390ascorbOXfungal3.0e-5641560559+
PLN02191PLN021912.0e-6647565548+
PLN02604PLN026043.0e-7947568552+
TIGR03388ascorbase3.0e-8347568550+
TIGR03389laccase034578545+
Gene Ontology
GO TermDescription
GO:0005507copper ion binding
GO:0016491oxidoreductase activity
GO:0055114oxidation-reduction process
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
RefSeqNP_001105915.103157837584putative laccase [Zea mays]
Swiss-ProtQ6Z8L203457833579LAC9_ORYSJ RecName: Full=Putative laccase-9; AltName: Full=Benzenediol:oxygen oxidoreductase 9; AltName: Full=Urishiol oxidase 9; AltName: Full=Diphenol oxidase 9; Flags: Precursor
RefSeqXP_002452548.103057843590hypothetical protein SORBIDRAFT_04g027860 [Sorghum bicolor]
RefSeqXP_002452900.103057833578hypothetical protein SORBIDRAFT_04g034610 [Sorghum bicolor]
RefSeqXP_002452901.102857844585hypothetical protein SORBIDRAFT_04g034620 [Sorghum bicolor]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB1asq_B04756819536A Chain A, Characterization And Engineering Of The Bifunctional N- And O-glucosyltransferase Involved In Xenobiotic Metabolism In Plants
PDB1asq_A04756819536A Chain A, Characterization And Engineering Of The Bifunctional N- And O-glucosyltransferase Involved In Xenobiotic Metabolism In Plants
PDB1asp_B04756819536A Chain A, Characterization And Engineering Of The Bifunctional N- And O-glucosyltransferase Involved In Xenobiotic Metabolism In Plants
PDB1asp_A04756819536A Chain A, Characterization And Engineering Of The Bifunctional N- And O-glucosyltransferase Involved In Xenobiotic Metabolism In Plants
PDB1aso_B04756819536A Chain A, Characterization And Engineering Of The Bifunctional N- And O-glucosyltransferase Involved In Xenobiotic Metabolism In Plants
Transmembrane Domains
StartEnd
729
Signal Peptide
Cleavage Site
30
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
DV48690624912490
EE185313275453190
HO797675507765790
GT79159122312230
GT8035612583205770
Orthologous Group
SpeciesID
Arabidopsis lyrata917686487747
Arabidopsis thalianaAT5G48100.1AT5G09360.1
Brachypodium distachyonBradi3g59210.1
Brassica rapaBra020720Bra037510
Capsella rubellaCarubv10027828mCarubv10000589m
Citrus clementinaCiclev10003795m
Citrus sinensisorange1.1g036841m
Cucumis sativusCucsa.345760.1
Eucalyptus grandisEucgr.L01441.1Eucgr.J00889.1Eucgr.F02650.1Eucgr.H04936.1Eucgr.F04163.1
Eucgr.F02674.1Eucgr.H04937.1Eucgr.F02648.1Eucgr.F02642.1Eucgr.F02646.1
Eucgr.L00623.1Eucgr.B01273.1Eucgr.H02579.1Eucgr.F02649.1Eucgr.F04160.1
Eucgr.F04162.1Eucgr.F02641.1Eucgr.F04154.1Eucgr.L01656.1Eucgr.F02644.1
Eucgr.L00621.1Eucgr.C02745.1Eucgr.J00888.1Eucgr.F02652.2Eucgr.F02652.1
Eucgr.L01343.1Eucgr.L02310.1Eucgr.E04216.1Eucgr.G00841.1Eucgr.E04217.1
Eucgr.E04220.1Eucgr.E04219.1Eucgr.E04218.1Eucgr.E04221.1Eucgr.L01345.1
Eucgr.E03935.1Eucgr.F04158.1Eucgr.F02653.1Eucgr.E03932.1Eucgr.F04157.1
Eucgr.F02642.2Eucgr.F02649.2
Fragaria vescamrna16187.1-v1.0-hybridmrna27556.1-v1.0-hybridmrna27557.1-v1.0-hybridmrna27526.1-v1.0-hybridmrna27527.1-v1.0-hybrid
mrna27523.1-v1.0-hybridmrna15091.1-v1.0-hybridmrna27531.1-v1.0-hybridmrna24290.1-v1.0-hybridmrna27522.1-v1.0-hybrid
mrna17621.1-v1.0-hybridmrna11910.1-v1.0-hybridmrna24296.1-v1.0-hybridmrna05430.1-v1.0-hybridmrna24295.1-v1.0-hybrid
mrna02152.1-v1.0-hybridmrna24292.1-v1.0-hybridmrna08067.1-v1.0-hybridmrna11940.1-v1.0-hybrid
Glycine maxGlyma11g36058.1Glyma16g27480.1Glyma10g36320.1Glyma20g31280.1Glyma10g36310.1
Glyma20g31270.1
Gossypium raimondiiGorai.009G260400.1Gorai.009G260400.2Gorai.005G076600.2Gorai.005G076600.1Gorai.005G076600.3
Gorai.009G260600.1Gorai.009G261300.1Gorai.009G261000.1Gorai.009G260800.1Gorai.010G130100.1
Gorai.009G260400.3Gorai.009G261100.1Gorai.009G261500.1
Linum usitatissimumLus10041067Lus10026812Lus10036070Lus10041066
Malus domesticaMDP0000546342MDP0000143780MDP0000168293MDP0000318606MDP0000262848
MDP0000090732MDP0000242301MDP0000252988MDP0000724206MDP0000419919
MDP0000188477MDP0000263468MDP0000148967
Manihot esculentacassava4.1_028126mcassava4.1_005540mcassava4.1_026478mcassava4.1_027769m
Medicago truncatulaMedtr3g101640.1.30.558Medtr3g101640.1.30.558Medtr2g008330.1
Mimulus guttatusmgv1a018195mmgv1a019066mmgv1a021399mmgv1a003690mmgv1a004060m
Oryza sativaLOC_Os02g51440.1LOC_Os11g47390.1
Panicum virgatumPavirv00068445mPavirv00039877mPavirv00029470mPavirv00044315mPavirv00029948m
Phaseolus vulgarisPhvul.004G086400.1Phvul.007G086400.1Phvul.007G086500.1Phvul.004G087000.1
Populus trichocarpaPotri.005G200600.1Potri.005G200500.1Potri.011G071100.1Potri.019G088900.1Potri.019G088500.1
Potri.019G088600.1Potri.019G088800.1Potri.019G088700.1Potri.019G088700.2Potri.005G200700.1
Potri.001G206200.1Potri.005G200500.2Potri.005G200600.2
Prunus persicappa016123mppa003529mppa003546mppa016865mppa015996m
ppa025323mppa003489mppa014804mppa003580mppa003663m
ppa003583mppa025087m
Ricinus communis28644.m00090929703.m00152429703.m00152729703.m00153128660.m000189
29703.m00153028644.m00094028644.m00093728644.m000938
Setaria italicaSi016752mSi007952mSi019864mSi019724m
Sorghum bicolorSb04g027860.1Sb04g034620.1Sb04g034610.1Sb04g027850.1Sb10g030340.1
Sb05g022480.1
Thellungiella halophilaThhalv10003921mThhalv10015612m
Vitis viniferaGSVIVT01001603001GSVIVT01012329001GSVIVT01013689001GSVIVT01013695001GSVIVT01013694001
GSVIVT01012332001GSVIVT01034783001GSVIVT01012343001GSVIVT01034842001GSVIVT01034817001
GSVIVT01001604001GSVIVT01001614001GSVIVT01012346001GSVIVT01013687001.321.754GSVIVT01013687001.321.754
GSVIVT01012359001GSVIVT01034828001GSVIVT01013692001
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)