y PlantCAZyme

CAZyme Information

Basic Information
SpeciesBrachypodium distachyon
Cazyme IDBradi3g59640.1
FamilyGH47
Protein PropertiesLength: 585 Molecular Weight: 65994.6 Isoelectric Point: 6.0834
ChromosomeChromosome/Scaffold: 3 Start: 58768317 End: 58773314
DescriptionGlycosyl hydrolase family 47 protein
View CDS
External Links
NCBI Taxonomy
Plaza
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GH47544880
  MFYHAYDNYMAYAFPHDELKPLTKSFTDSLSELGNLNLEHLPHDYNGSALTLVESLSSLVVLGNLTEFERGVTWLSENLTFDVDARVNLFECNIRLLGGL
  ISAHILAKDYISQRKDGVYQDQLLHLAENLGSRFLPAFETPTGLPYAWINLKYGVIENETTETSTSGCGSLILEMGALSRLTGDSRYEAAAHRALRKLWS
  MRSSLNLVGSTLDVLSGKWIEYSSGIGAGVDSFYEYLIKAYILFGSDEYWDMFHSAYLAVQKYFRHGPWYHEADIRTGEATHWQLTSLQAFWPGVQTLLG
  DVAAANLSHREFYNVWQRFGVLPERYLLDYGILHPTEKYYPLRPEFAESTFYLYQATKDPWYLEVGEAIIGSLNYYTKVEGGFASIRDVSTMKQEDHQHS
  FFLSETCKYLFLLYDDSFLRKQNYIFTTEGHPLPI
Full Sequence
Protein Sequence     Length: 585     Download
MRSPRLLRPA PARLVAAALL LAALAGGAAA ADISGRDGYG RARRLHMRDK VVEMFYHAYD    60
NYMAYAFPHD ELKPLTKSFT DSLSELGNLN LEHLPHDYNG SALTLVESLS SLVVLGNLTE    120
FERGVTWLSE NLTFDVDARV NLFECNIRLL GGLISAHILA KDYISQRKDG VYQDQLLHLA    180
ENLGSRFLPA FETPTGLPYA WINLKYGVIE NETTETSTSG CGSLILEMGA LSRLTGDSRY    240
EAAAHRALRK LWSMRSSLNL VGSTLDVLSG KWIEYSSGIG AGVDSFYEYL IKAYILFGSD    300
EYWDMFHSAY LAVQKYFRHG PWYHEADIRT GEATHWQLTS LQAFWPGVQT LLGDVAAANL    360
SHREFYNVWQ RFGVLPERYL LDYGILHPTE KYYPLRPEFA ESTFYLYQAT KDPWYLEVGE    420
AIIGSLNYYT KVEGGFASIR DVSTMKQEDH QHSFFLSETC KYLFLLYDDS FLRKQNYIFT    480
TEGHPLPIRS TWHEKIPASD VPSNWTSVKD AEQPIRVSAL SSQVCPETIF RQSFGSTWES    540
ACHVPDVFPN HKCRADDDCG IESVSCKRRT CSTAGYCGLW LAVL*                    600
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
TIGR03897lanti_2_LanM0.009173309143+
PTZ00470PTZ004706.0e-6548488478+
pfam01532Glyco_hydro_472.0e-14354488472+
Gene Ontology
GO TermDescription
GO:0004571mannosyl-oligosaccharide 1,2-alpha-mannosidase activity
GO:0005509calcium ion binding
GO:0016020membrane
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankEEC73977.103758338584hypothetical protein OsI_08885 [Oryza sativa Indica Group]
RefSeqNP_001048080.103758338584Os02g0741300 [Oryza sativa (japonica cultivar-group)]
RefSeqXP_002280345.104258330573PREDICTED: hypothetical protein [Vitis vinifera]
RefSeqXP_002454305.103558330572hypothetical protein SORBIDRAFT_04g028330 [Sorghum bicolor]
RefSeqXP_002511454.104258334575Mannosyl-oligosaccharide 1,2-alpha-mannosidase IA, putative [Ricinus communis]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB1nxc_A04850021477A Chain A, Structure Of Mouse Golgi Alpha-1,2-Mannosidase Ia Reveals The Molecular Basis For Substrate Specificity Among Class I Enzymes (Family 47 Glycosidases)
PDB1fmi_A0454887456A Chain A, Crystal Structure Of Human Class I Alpha1,2-Mannosidase
PDB1fo3_A0454887456A Chain A, Crystal Structure Of Human Class I Alpha1,2-Mannosidase
PDB1fo2_A0454887456A Chain A, Crystal Structure Of Human Class I Alpha1,2-Mannosidase In Complex With 1-Deoxymannojirimycin
PDB1x9d_A04048880534A Chain A, Crystal Structure Of Human Class I Alpha-1,2-Mannosidase In Complex With Thio-Disaccharide Substrate Analogue
Transmembrane Domains
StartEnd
1335
Signal Peptide
Cleavage Site
30
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
GT0483762962535480
CJ6836372762204950
GT8335142583205770
CJ7265442612204800
GT048376365475820.16
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_018_00031.1Aquca_018_00031.2Aquca_018_00031.3Aquca_125_00025.1Aquca_125_00025.2
Aquca_125_00025.3Aquca_125_00025.4Aquca_049_00074.1Aquca_002_00310.1Aquca_125_00025.5
Aquca_002_00310.2
Arabidopsis lyrata479633474272890537494638472957
Arabidopsis thalianaAT3G21160.1AT1G51590.1AT1G51590.2AT1G30000.1AT5G43710.1
AT1G27520.1
Brachypodium distachyonBradi5g20920.1Bradi2g32570.1Bradi2g51467.1
Brassica rapaBra001816Bra014291Bra018917Bra031256Bra010804
Bra032351Bra032833Bra035984
Carica papayaevm.model.supercontig_95.2evm.model.supercontig_166.13evm.model.supercontig_95.1evm.model.supercontig_67.12evm.model.supercontig_110.19
evm.model.supercontig_58.25
Capsella rubellaCarubv10008737mCarubv10013330mCarubv10008589mCarubv10028673mCarubv10008651m
Chlamydomonas reinhardtiiCre07.g336600.t2.1Cre07.g336600.t1.3Cre06.g301600.t1.3.289.614Cre06.g301600.t1.3.289.614Cre06.g301600.t1.3.61.154
Cre06.g301600.t1.3.61.154
Citrus clementinaCiclev10025230mCiclev10014607mCiclev10019471mCiclev10004553m
Citrus sinensisorange1.1g008341morange1.1g008300morange1.1g008122morange1.1g047597m
Cucumis sativusCucsa.359580.9Cucsa.359580.8Cucsa.359580.1Cucsa.047700.1Cucsa.197180.1
Cucsa.254850.1Cucsa.197180.2
Eucalyptus grandisEucgr.F04021.3Eucgr.F04021.2Eucgr.F04021.1Eucgr.C00102.1Eucgr.D00298.2
Eucgr.D00298.1Eucgr.B00341.1Eucgr.H00217.1Eucgr.D00298.3.295.528Eucgr.D00298.3.295.528
Eucgr.D00298.3.92.294Eucgr.D00298.3.92.294
Fragaria vescamrna30596.1-v1.0-hybridmrna05270.1-v1.0-hybrid.98.305mrna05270.1-v1.0-hybrid.98.305mrna17280.1-v1.0-hybrid.95.302mrna17280.1-v1.0-hybrid.95.302
mrna05270.1-v1.0-hybrid.306.507mrna05270.1-v1.0-hybrid.306.507mrna17280.1-v1.0-hybrid.303.483mrna17280.1-v1.0-hybrid.303.483mrna32588.1-v1.0-hybrid
mrna09481.1-v1.0-hybrid.43.302mrna09481.1-v1.0-hybrid.43.302mrna29049.1-v1.0-hybridmrna09481.1-v1.0-hybrid.302.439mrna09481.1-v1.0-hybrid.302.439
Glycine maxGlyma07g02290.1Glyma08g23730.1Glyma17g06600.2Glyma17g06600.1Glyma13g00470.2
Glyma15g10130.1Glyma13g28910.1Glyma13g28910.2Glyma05g01830.1Glyma10g32320.1
Glyma17g10060.1Glyma17g10060.3Glyma17g10060.2Glyma05g22295.1Glyma20g35290.1
Gossypium raimondiiGorai.005G122200.2Gorai.005G122200.1Gorai.011G003500.6Gorai.011G003500.2Gorai.011G003500.1
Gorai.011G003500.3Gorai.011G003500.4Gorai.011G003500.5Gorai.010G238600.1Gorai.009G155100.5
Gorai.009G155100.2Gorai.009G155100.1Gorai.009G155100.4Gorai.009G155100.3Gorai.006G187900.2
Gorai.006G187900.1Gorai.006G245800.2Gorai.006G245800.1Gorai.006G187900.3Gorai.006G187900.4
Linum usitatissimumLus10034820Lus10035727Lus10037312Lus10042830Lus10033368.153.381
Lus10033368.153.381Lus10028127Lus10042143Lus10033368.428.563Lus10033368.428.563
Lus10041170Lus10021888.49.301Lus10021888.49.301Lus10004233Lus10021888.303.456
Lus10021888.303.456
Malus domesticaMDP0000857857MDP0000308427MDP0000143766MDP0000156362.354.619MDP0000156362.354.619
MDP0000167309MDP0000316328MDP0000156362.225.356MDP0000156362.225.356MDP0000268730.351.588
MDP0000268730.351.588MDP0000268730.596.800MDP0000268730.596.800MDP0000230215MDP0000208346
MDP0000245188.48.176MDP0000245188.48.176MDP0000319401.48.275MDP0000319401.48.275MDP0000319401.311.449
MDP0000319401.311.449MDP0000245188.210.319MDP0000245188.210.319MDP0000222952
Manihot esculentacassava4.1_026203mcassava4.1_003593mcassava4.1_003599mcassava4.1_011906mcassava4.1_015511m
cassava4.1_003747mcassava4.1_004429m
Medicago truncatulaMedtr4g127310.1Medtr2g019520.2Medtr2g019520.1Medtr2g019520.3Medtr4g106370.1
Medtr1g093270.1
Mimulus guttatusmgv1a003772mmgv1a002872mmgv1a025048mmgv1a002884m
Oryza sativaLOC_Os04g51690.1LOC_Os05g11850.1LOC_Os01g56670.1LOC_Os01g56670.3LOC_Os01g56670.2
LOC_Os02g50780.1LOC_Os01g56670.4
Panicum virgatumPavirv00024177mPavirv00056286mPavirv00057415mPavirv00052269mPavirv00016853m
Pavirv00054954mPavirv00016455mPavirv00000605mPavirv00017739m
Physcomitrella patensPp1s387_34V6.1Pp1s16_48V6.1Pp1s58_280V6.1Pp1s313_34V6.1
Phaseolus vulgarisPhvul.008G254800.1Phvul.003G140700.1Phvul.006G164400.1Phvul.003G197300.1Phvul.007G109800.1
Phvul.006G033000.1Phvul.011G127200.1
Picea abiesMA_10430881g0010MA_10426596g0010MA_311901g0010MA_10180832g0010MA_170877g0010
MA_8281735g0010MA_118584g0010
Populus trichocarpaPotri.018G141100.2Potri.018G141100.1Potri.008G007500.1Potri.008G007500.2Potri.018G141100.3
Potri.018G141100.4Potri.004G132300.1Potri.004G132300.2Potri.004G132300.4Potri.004G132300.3
Potri.015G071400.1Potri.012G076600.1Potri.008G160900.1Potri.015G071400.2Potri.012G076600.2
Prunus persicappa004310mppa026880mppa002795mppa003534mppa002909m
ppa012357m
Ricinus communis28359.m00028030063.m00145129693.m00202130147.m01400429844.m003177
Setaria italicaSi013487mSi009718mSi021445mSi016751mSi004250m
Selaginella moellendorffii1013518511116848592622229806
228194
Sorghum bicolorSb06g027810.1Sb09g006500.1Sb03g036080.1Sb04g028330.1
Thellungiella halophilaThhalv10011358mThhalv10020383mThhalv10007084mThhalv10003168mThhalv10007201m
Vitis viniferaGSVIVT01029601001GSVIVT01029306001GSVIVT01029623001GSVIVT01021446001GSVIVT01007818001
GSVIVT01018097001GSVIVT01029609001
Volvox carteriVocar20012263m
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)