y PlantCAZyme

CAZyme Information

Basic Information
SpeciesBrachypodium distachyon
Cazyme IDBradi3g60820.2
FamilyGT13
Protein PropertiesLength: 443 Molecular Weight: 51501.9 Isoelectric Point: 6.861
ChromosomeChromosome/Scaffold: 3 Start: 59632152 End: 59637367
Descriptionalpha-1,3-mannosyl-glycoprotein beta-1,2-N-acetylglucosaminyltransferase, putative
View CDS
External Links
NCBI Taxonomy
Plaza
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GT13224370
  IQVRLFSTQSHHSERLAEAEKLENKCTDQLRSMIDQVSAQQEKIVALEEMKLRQDEERVQLKILIQDLEKRSLQTSVNKDVVPVAAVVIMACNRPDYLQR
  TVESILKYQTAVASKFPLFISQDGTNGEVKKKALSYTRITFMQHVDLEPVRTERPGEMTAYYKIAKHYKWALDQLFLKHSFGRVIILEDDMEIAPDFFDY
  FEAAAKLLDDDKTIMAVSSWNDNGQKQFVYDPKALYRSDFFPGLGWMLTKPTWIELSPKWPKAYWDDWVRLKEVHRDRQFIRPEVCRTYNFGEHGSSMGQ
  FFNQYLEPIKLNDVHIDWNSEDLSYLREDKFLIQFGKEVASATPLHGSDALLKAHNMDVDVRIQYNDQGDFERIARQFGIFEEWKDGVPRAAYKGVVMFR
  YKSSRRRIYLVGPDSL
Full Sequence
Protein Sequence     Length: 443     Download
MARNPCDIRF LLLAAAAAFI YIQVRLFSTQ SHHSERLAEA EKLENKCTDQ LRSMIDQVSA    60
QQEKIVALEE MKLRQDEERV QLKILIQDLE KRSLQTSVNK DVVPVAAVVI MACNRPDYLQ    120
RTVESILKYQ TAVASKFPLF ISQDGTNGEV KKKALSYTRI TFMQHVDLEP VRTERPGEMT    180
AYYKIAKHYK WALDQLFLKH SFGRVIILED DMEIAPDFFD YFEAAAKLLD DDKTIMAVSS    240
WNDNGQKQFV YDPKALYRSD FFPGLGWMLT KPTWIELSPK WPKAYWDDWV RLKEVHRDRQ    300
FIRPEVCRTY NFGEHGSSMG QFFNQYLEPI KLNDVHIDWN SEDLSYLRED KFLIQFGKEV    360
ASATPLHGSD ALLKAHNMDV DVRIQYNDQG DFERIARQFG IFEEWKDGVP RAAYKGVVMF    420
RYKSSRRRIY LVGPDSLSQL GV*                                            480
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
cd02514GT13_GLCNAC-TI1.0e-162110436332+
pfam03071GNT-I019441429+
Gene Ontology
GO TermDescription
GO:0000139Golgi membrane
GO:0003827alpha-1,3-mannosylglycoprotein 2-beta-N-acetylglucosaminyltransferase activity
GO:0006487protein N-linked glycosylation
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankACF83572.1014421425unknown [Zea mays]
GenBankACG37957.1014421442N-acetylglucosaminyltransferase I [Zea mays]
RefSeqNP_001048631.1014421442Os02g0832800 [Oryza sativa (japonica cultivar-group)]
RefSeqNP_001142278.1014421442hypothetical protein LOC100274447 [Zea mays]
RefSeqXP_002441861.1014421442hypothetical protein SORBIDRAFT_08g003660 [Sorghum bicolor]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB1foa_A01054368339A Chain A, Crystal Structure Of N-acetylglucosaminyltransferase I
PDB1fo9_A01054368339A Chain A, Crystal Structure Of N-acetylglucosaminyltransferase I
PDB1fo8_A01054363334A Chain A, Crystal Structure Of N-Acetylglucosaminyltransferase I
PDB2apc_A01054362333A Chain A, Crystal Structure Of N-Acetylglucosaminyltransferase I
PDB2am5_A01054362333A Chain A, Crystal Structure Of N-Acetylglucosaminyltransferase I
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
GO802527323293500
GT0474702951214150
GO802714312293390
GO865783318193360
GO802714233403626.8
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_007_00911.3Aquca_007_00911.4Aquca_007_00911.2Aquca_007_00911.1Aquca_007_00911.5
Arabidopsis lyrata912565490588
Arabidopsis thalianaAT4G38240.1AT4G38240.2AT4G38240.3
Brachypodium distachyonBradi3g60820.3Bradi3g60820.1
Brassica rapaBra033557
Carica papayaevm.TU.contig_28580.1.22.235evm.TU.contig_28580.1.235.387evm.TU.contig_28580.1.235.387evm.TU.contig_28580.1.22.235
Capsella rubellaCarubv10007540m
Citrus clementinaCiclev10028418m
Citrus sinensisorange1.1g019888morange1.1g012912morange1.1g012941m
Cucumis sativusCucsa.099720.1Cucsa.099720.2
Eucalyptus grandisEucgr.L00584.1Eucgr.L00583.1Eucgr.H04987.1Eucgr.H04987.2Eucgr.H04989.3
Eucgr.H04989.2Eucgr.H04989.4Eucgr.H04989.1
Fragaria vescamrna17328.1-v1.0-hybrid
Glycine maxGlyma04g00200.1Glyma06g00230.1
Gossypium raimondiiGorai.008G014000.2Gorai.008G014000.3Gorai.008G014000.1
Linum usitatissimumLus10022994Lus10001389
Malus domesticaMDP0000173465.283.435MDP0000170967.230.351MDP0000170967.22.209MDP0000170967.22.209MDP0000173465.283.435
MDP0000173465.22.268MDP0000173465.22.268MDP0000170967.230.351
Manihot esculentacassava4.1_024783m
Medicago truncatulaMedtr3g118520.1Medtr3g118520.2Medtr3g118520.3
Mimulus guttatusmgv1a006517mmgv1a006750m
Oryza sativaLOC_Os02g58590.1.304.426LOC_Os02g58590.1.304.426LOC_Os02g58590.1.22.283LOC_Os02g58590.1.22.283
Panicum virgatumPavirv00053907mPavirv00020030m
Physcomitrella patensPp1s100_54V6.1Pp1s246_61V6.1
Phaseolus vulgarisPhvul.009G115600.1
Picea abiesMA_901813g0010
Populus trichocarpaPotri.009G168000.2Potri.009G168000.1Potri.009G168000.4Potri.004G206900.3Potri.004G206900.1
Potri.004G206900.2Potri.009G168000.3
Prunus persicappa006221m
Ricinus communis29675.m000398.22.23129675.m000398.232.34829675.m000398.232.34829675.m000398.22.231
Setaria italicaSi006441mSi006440m
Selaginella moellendorffii268301
Sorghum bicolorSb08g003660.1
Thellungiella halophilaThhalv10025211mThhalv10025208mThhalv10025250m
Vitis viniferaGSVIVT01002028001GSVIVT01002907001
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny