y PlantCAZyme

CAZyme Information

Basic Information
SpeciesBrachypodium distachyon
Cazyme IDBradi4g03380.2
FamilyGT4
Protein PropertiesLength: 473 Molecular Weight: 53048.4 Isoelectric Point: 7.9148
ChromosomeChromosome/Scaffold: 4 Start: 2707337 End: 2710561
DescriptionUDP-Glycosyltransferase superfamily protein
View CDS
External Links
NCBI Taxonomy
Plaza
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GT42674292.9e-23
  PPILISVAQFRPEKAHGLQLEAFALALQRLDPDSIKPKLQFVGSCRNKEDLERLQKLEDRSVELRIDELVEFHKDISYRDLVQLLGGAIAGLHSMTDEHF
  GISVVEYMAAGAIPIAHKSAGPMMDIVLEEDGHQTGFLASDKEEFTEAILKVLRMPETGRQEM
Full Sequence
Protein Sequence     Length: 473     Download
MAILACLLTV VPTILGLAIR RLRILLRFPS PHAAAGFFHP YTNDGGGGER VLWCAVRAVQ    60
DLCPGLPCAV FTGDADASPD GLAARALDRF GVRLLRPPQV VHLNKRKWIE ASTYPHFTMI    120
GQSLGSVYLA WEALNKFAPQ FYFDTSGYAF TYPLARLFGC EVICYTHYPT ISSDMVERVK    180
QRNSMYNNNS RISGSIWLSR CKILYYTIFS WLYGLVGSCA HLVMVNSSWT RSHIVNIWKI    240
PECTKRVYPP CDTSALQMLP LERSTMPPIL ISVAQFRPEK AHGLQLEAFA LALQRLDPDS    300
IKPKLQFVGS CRNKEDLERL QKLEDRSVEL RIDELVEFHK DISYRDLVQL LGGAIAGLHS    360
MTDEHFGISV VEYMAAGAIP IAHKSAGPMM DIVLEEDGHQ TGFLASDKEE FTEAILKVLR    420
MPETGRQEMA AAARKRAQRF SEKRFHEDFT DAVRPILSAT EGRHVQMSPL IE*           480
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
pfam00534Glycos_transf_11.0e-22267436172+
cd03801GT1_YqgM_like8.0e-23197454270+
cd03805GT1_ALG2_like5.0e-30108445354+
PLN02949PLN02949029459431+
cd03806GT1_ALG11_like036448417+
Gene Ontology
GO TermDescription
GO:0009058biosynthetic process
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankABA99697.102946026457glycosyl transferase, group 1 family protein, expressed [Oryza sativa (japonica cultivar-group)]
GenBankEAZ21019.102946026413hypothetical protein OsJ_36668 [Oryza sativa Japonica Group]
RefSeqNP_001142345.102346221460hypothetical protein LOC100274516 [Zea mays]
RefSeqNP_181548.203445935460glycosyl transferase family 1 protein [Arabidopsis thaliana]
RefSeqXP_002443441.103446232460hypothetical protein SORBIDRAFT_08g019540 [Sorghum bicolor]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB2f9f_A0.0000327144027177A Chain A, Crystal Structure Of The Putative Mannosyl Transferase (Wbaz-1)from Archaeoglobus Fulgidus, Northeast Structural Genomics Target Gr29a
PDB2xa1_B0.0002364439326396A Chain A, Crystal Structure Of Trehalose Synthase Tret From P. Horikoshii (Seleno Derivative)
PDB2xa1_A0.0002364439326396A Chain A, Crystal Structure Of Trehalose Synthase Tret From P. Horikoshii (Seleno Derivative)
PDB2x6r_B0.0002364439326396A Chain A, Crystal Structure Of Trehalose Synthase Tret From P. Horikoshii (Seleno Derivative)
PDB2x6r_A0.0002364439326396A Chain A, Crystal Structure Of Trehalose Synthase Tret From P. Horikoshii (Seleno Derivative)
Metabolic Pathways
Pathway NameReactionECProtein Name
dolichyl-diphosphooligosaccharide biosynthesisRXN-5464EC-2.4.1.131GDP-Man:Man3GlcNAc2-PP-Dol α-1,2-mannosyltransferase
Transmembrane Domains
StartEnd
219
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
GO8408993391074450
GT0503453211374570
BG8380292871764620
DY263372357333880
JG9476092751874610
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_045_00152.10Aquca_045_00152.3Aquca_045_00152.4Aquca_045_00152.7Aquca_045_00152.8
Aquca_045_00152.2Aquca_045_00152.1Aquca_013_00559.1Aquca_013_00559.3
Arabidopsis lyrata497266
Arabidopsis thalianaAT2G40190.1
Brassica rapaBra004979Bra017025
Capsella rubellaCarubv10023116m
Chlamydomonas reinhardtiig1252.t1
Citrus clementinaCiclev10031450m
Citrus sinensisorange1.1g012436m
Cucumis sativusCucsa.368390.1
Eucalyptus grandisEucgr.G03076.1
Glycine maxGlyma16g02840.1Glyma07g06210.1
Gossypium raimondiiGorai.013G017200.1
Linum usitatissimumLus10028977
Manihot esculentacassava4.1_010258m
Medicago truncatulaAC235758_14.1AC233112_1009.1
Mimulus guttatusmgv1a005920m
Oryza sativaLOC_Os12g39340.1
Panicum virgatumPavirv00014744mPavirv00065689m
Physcomitrella patensPp1s269_93V6.1
Phaseolus vulgarisPhvul.010G113600.1
Populus trichocarpaPotri.012G095500.1
Prunus persicappa005444m
Ricinus communis29814.m000733
Setaria italicaSi021990m
Selaginella moellendorffii80274
Sorghum bicolorSb08g019540.1
Thellungiella halophilaThhalv10016619m
Vitis viniferaGSVIVT01032791001
Volvox carteriVocar20008969m
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny