y PlantCAZyme

CAZyme Information

Basic Information
SpeciesBrachypodium distachyon
Cazyme IDBradi4g04620.1
FamilyCE8
Protein PropertiesLength: 413 Molecular Weight: 43964.9 Isoelectric Point: 9.616
ChromosomeChromosome/Scaffold: 4 Start: 3795674 End: 3797076
DescriptionPectin lyase-like superfamily protein
View CDS
External Links
NCBI Taxonomy
Plaza
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
CE81084010
  YVVSPNGKGKFRTISEAIKAIPEKNKQRVILDIQPGTYKEKFLIPTTKPFVTFLGNPRNPPVITWDDTAGTRGKDGAPIGTLGSATVAIESDYFMASGIV
  FKNHAPLAPPGAKGGQAVALRVFGTKAAFYNCTFDGGQDTLYDNKGLHYFKNCVVKGSVDFIFGFGRSLYVDCTMVSVTSQVAVLTAQQRSRSIAEATES
  GFSFVRCKIMGMGQIYLGRAWGDSSRVVYSFTDMGKEVIPVGWDGWNVEKPERTGVYYGEYKCSGPGAMSTQRIGWARVLDDTQARPFTGSHFV
Full Sequence
Protein Sequence     Length: 413     Download
MEGDKSKTPS FAIAFLVLLL LASSFPPATS QHQQASFVIG GNGGGGGNKP SSGSAGGGGG    60
AGSFDDFITK NVQHYAVTEQ LYASKAKANG GKLLDADLSA AEAAKVRYVV SPNGKGKFRT    120
ISEAIKAIPE KNKQRVILDI QPGTYKEKFL IPTTKPFVTF LGNPRNPPVI TWDDTAGTRG    180
KDGAPIGTLG SATVAIESDY FMASGIVFKN HAPLAPPGAK GGQAVALRVF GTKAAFYNCT    240
FDGGQDTLYD NKGLHYFKNC VVKGSVDFIF GFGRSLYVDC TMVSVTSQVA VLTAQQRSRS    300
IAEATESGFS FVRCKIMGMG QIYLGRAWGD SSRVVYSFTD MGKEVIPVGW DGWNVEKPER    360
TGVYYGEYKC SGPGAMSTQR IGWARVLDDT QARPFTGSHF VYGNSWILPP PK*           420
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
PLN02304PLN023045.0e-85110409308+
PLN02671PLN026718.0e-94109407302+
PLN02634PLN026342.0e-96109409301+
PLN02682PLN026821.0e-117109409302+
PLN02665PLN026652.0e-119110412305+
Gene Ontology
GO TermDescription
GO:0005618cell wall
GO:0030599pectinesterase activity
GO:0042545cell wall modification
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankEAY81792.105041237399hypothetical protein OsI_36964 [Oryza sativa Indica Group]
GenBankEEC69509.102341229413hypothetical protein OsI_38743 [Oryza sativa Indica Group]
RefSeqNP_001067039.102741233412Os12g0563700 [Oryza sativa (japonica cultivar-group)]
RefSeqNP_001068464.105041137398Os11g0683700 [Oryza sativa (japonica cultivar-group)]
RefSeqXP_002443368.103941252430hypothetical protein SORBIDRAFT_08g018360 [Sorghum bicolor]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB1gq8_A2.94273e-4410940710308A Chain A, Pectin Methylesterase From Carrot
PDB1xg2_A6e-381094076304B Chain B, Crystal Structure Of The Complex Between Pectin Methylesterase And Its Inhibitor Protein
PDB1qjv_B2e-1811128412192A Chain A, Pectin Methylesterase Pema From Erwinia Chrysanthemi
PDB1qjv_A2e-1811128412192A Chain A, Pectin Methylesterase Pema From Erwinia Chrysanthemi
PDB2ntq_B2e-1811128412192A Chain A, Pectin Methylesterase Pema From Erwinia Chrysanthemi
Metabolic Pathways
Pathway NameReactionECProtein Name
homogalacturonan degradationRXN-2102EC-3.1.1.11pectinesterase
Signal Peptide
Cleavage Site
30
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
CX0995442301814100
DY5367752042104110
EX5945232031483480
DR7886462241944130
CX099544241551780.69
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_003_00441.1Aquca_007_00353.1Aquca_001_00227.1Aquca_013_00738.1Aquca_025_00035.1
Aquca_054_00116.1Aquca_019_00164.1Aquca_009_01081.1Aquca_013_00738.2Aquca_010_00518.1
Aquca_076_00020.1Aquca_076_00019.1Aquca_002_00695.2Aquca_019_00164.2Aquca_002_00695.1
Aquca_002_00695.3Aquca_029_00012.1Aquca_015_00128.1Aquca_003_00510.1
Arabidopsis lyrata488866494222878699482653495646
320010902790905199487574325356
358371479173487573862304873977
892826480819892828489513
Arabidopsis thalianaAT5G19730.1AT5G47500.1AT1G05310.1AT5G55590.1AT2G36710.1
AT2G21610.1AT2G36700.1AT3G29090.1AT5G07410.1AT1G69940.1
AT5G07430.1AT5G61680.1AT3G17060.1AT5G07420.1AT3G24130.1
AT5G18990.1AT2G47280.1AT2G19150.1AT5G26810.1
Brachypodium distachyonBradi2g49500.1Bradi1g21810.1Bradi5g17850.1Bradi3g17880.1Bradi4g38840.1
Bradi4g09910.1Bradi3g24750.1Bradi2g44500.1Bradi4g00840.1Bradi1g64340.1
Bradi2g11470.1Bradi2g19420.1Bradi1g19360.1
Brassica rapaBra002257Bra020059Bra024939Bra022135Bra032469
Bra035579Bra005252Bra031204Bra005248Bra025376
Bra028699Bra033083Bra012932Bra009264Bra040910
Bra009265Bra036219Bra030289Bra005934Bra028698
Bra001652Bra022194Bra002891.216.401Bra002891.216.401Bra020099
Bra001928Bra028358Bra009921Bra038160Bra027892
Carica papayaevm.model.supercontig_145.20evm.model.supercontig_860.2evm.model.supercontig_29.158evm.model.supercontig_12.174evm.model.supercontig_82.70
evm.model.supercontig_5.133evm.model.supercontig_3.25evm.model.supercontig_14.109evm.model.supercontig_82.68evm.model.supercontig_8.283
evm.model.supercontig_3.28evm.model.supercontig_1973.3evm.model.supercontig_3.26evm.model.supercontig_59.133evm.model.supercontig_48.170
evm.model.supercontig_48.169
Capsella rubellaCarubv10001159mCarubv10026646mCarubv10028546mCarubv10023328mCarubv10006308m
Carubv10025460mCarubv10007965mCarubv10025126mCarubv10026738mCarubv10003776m
Carubv10023489mCarubv10003415mCarubv10017664mCarubv10015726mCarubv10003407m
Carubv10021951mCarubv10003190mCarubv10016365mCarubv10021607mCarubv10021724m
Carubv10003078mCarubv10011085m
Citrus clementinaCiclev10027321mCiclev10024027mCiclev10010616mCiclev10010593mCiclev10020787m
Ciclev10011953mCiclev10010655mCiclev10013444mCiclev10029966mCiclev10006909m
Ciclev10030015mCiclev10029855mCiclev10031872mCiclev10030026mCiclev10012239m
Ciclev10030318mCiclev10012403mCiclev10024124mCiclev10007120mCiclev10003837m
Ciclev10021167m.157.314Ciclev10021167m.157.314
Citrus sinensisorange1.1g019696morange1.1g043630morange1.1g018249morange1.1g016757morange1.1g047018m
orange1.1g039329morange1.1g046043morange1.1g042845morange1.1g038331morange1.1g039631m
orange1.1g021162morange1.1g046674morange1.1g039481morange1.1g021844morange1.1g024928m
orange1.1g043974morange1.1g038332morange1.1g036280morange1.1g044741morange1.1g043115m
orange1.1g039887m
Cucumis sativusCucsa.288760.2Cucsa.128610.1Cucsa.201150.1Cucsa.142040.1Cucsa.390850.1
Cucsa.301820.1Cucsa.288760.1Cucsa.378940.1Cucsa.232060.1Cucsa.109560.1
Cucsa.252510.1Cucsa.158110.1Cucsa.180130.1Cucsa.086770.1Cucsa.086750.1
Cucsa.086760.1Cucsa.086780.1Cucsa.158110.2.116.272Cucsa.158110.2.116.272Cucsa.193880.1
Cucsa.300590.1
Eucalyptus grandisEucgr.H00909.1Eucgr.E00425.1Eucgr.F03696.1Eucgr.H00909.2Eucgr.H04905.1
Eucgr.G01685.1Eucgr.F01579.1Eucgr.F01580.1Eucgr.C03721.1Eucgr.K00113.1
Eucgr.G02070.1Eucgr.H04048.1Eucgr.C02449.1Eucgr.H03295.1Eucgr.H03297.1
Eucgr.J02397.1Eucgr.H02786.1Eucgr.L00260.1Eucgr.H00056.1Eucgr.H03296.1
Eucgr.L00259.1Eucgr.C02448.1Eucgr.L00258.1Eucgr.B01686.1Eucgr.L00257.1.167.347
Eucgr.L00257.1.167.347Eucgr.F01581.1
Fragaria vescamrna11323.1-v1.0-hybridmrna12930.1-v1.0-hybridmrna23525.1-v1.0-hybridmrna24220.1-v1.0-hybridmrna08938.1-v1.0-hybrid
mrna00093.1-v1.0-hybridmrna30193.1-v1.0-hybridmrna05106.1-v1.0-hybridmrna04412.1-v1.0-hybridmrna11394.1-v1.0-hybrid
mrna21405.1-v1.0-hybridmrna24221.1-v1.0-hybridmrna15140.1-v1.0-hybridmrna31599.1-v1.0-hybridmrna05650.1-v1.0-hybrid.648.931
mrna05650.1-v1.0-hybrid.648.931mrna05650.1-v1.0-hybrid.648.931mrna05650.1-v1.0-hybrid.648.931mrna20388.1-v1.0-hybridmrna00138.1-v1.0-hybrid
mrna05650.1-v1.0-hybrid.325.608mrna05650.1-v1.0-hybrid.325.608mrna05650.1-v1.0-hybrid.325.608mrna05650.1-v1.0-hybrid.325.608mrna09634.1-v1.0-hybrid
mrna05650.1-v1.0-hybrid.125.274mrna05650.1-v1.0-hybrid.125.274mrna05650.1-v1.0-hybrid.125.274mrna05650.1-v1.0-hybrid.125.274
Glycine maxGlyma01g01010.1Glyma05g35930.1Glyma08g03700.1Glyma07g14930.2Glyma11g03560.1
Glyma01g41820.1Glyma17g15070.1Glyma19g32760.1Glyma01g01010.2Glyma14g01820.1
Glyma19g37180.1Glyma02g46890.1Glyma13g17390.3Glyma13g17390.2Glyma09g03960.1
Glyma14g01830.1Glyma09g36950.2Glyma09g36950.1Glyma02g46880.2Glyma18g49740.2
Glyma18g49740.1Glyma02g13820.1Glyma13g05650.1Glyma01g08730.1Glyma01g08690.1
Glyma01g08760.1Glyma01g09350.1Glyma19g03050.2Glyma16g09471.1Glyma02g09540.2
Glyma14g02385.1Glyma10g28753.1Glyma02g46400.2Glyma07g27450.2Glyma09g00620.2
Glyma04g33861.1
Gossypium raimondiiGorai.008G137400.1Gorai.008G064400.2Gorai.008G064400.1Gorai.010G077800.1Gorai.001G009400.1
Gorai.002G098600.1Gorai.013G154000.1Gorai.001G093600.1Gorai.003G171400.1Gorai.008G064400.3
Gorai.008G235300.1Gorai.006G160500.1Gorai.001G009400.2Gorai.005G244300.1Gorai.003G171400.2
Gorai.001G130900.1Gorai.009G201000.1Gorai.013G154000.2Gorai.009G272500.1Gorai.009G272700.1
Gorai.002G030400.1Gorai.006G014000.1Gorai.008G212700.1Gorai.008G213000.1Gorai.003G110300.1
Gorai.008G212500.1Gorai.003G110500.1Gorai.008G138100.1Gorai.006G014000.2Gorai.N023200.1
Gorai.008G212700.2Gorai.008G212900.1Gorai.008G213000.2Gorai.008G212600.1Gorai.008G212800.1
Gorai.013G207800.1Gorai.006G222300.1Gorai.013G129900.1
Linum usitatissimumLus10009997Lus10012942Lus10011132Lus10028364Lus10041815
Lus10043035Lus10010470Lus10004720Lus10016605Lus10027737
Lus10034893Lus10026347Lus10041699Lus10040541Lus10026047
Lus10014338Lus10023560Lus10037774Lus10042315Lus10024050
Lus10016711Lus10007113Lus10016678Lus10031421Lus10007136
Lus10000935Lus10000936Lus10010912.37.279Lus10010912.37.279Lus10010912.283.530
Lus10010912.283.530Lus10035553
Malus domesticaMDP0000218868MDP0000177299MDP0000212502MDP0000146743MDP0000306862
MDP0000172708MDP0000474161MDP0000936886MDP0000278119MDP0000181239
MDP0000528429MDP0000857958MDP0000195096MDP0000123530MDP0000768667
MDP0000446321MDP0000219907MDP0000870113MDP0000278118MDP0000184228
MDP0000376664MDP0000549344MDP0000401070MDP0000252508MDP0000251256
MDP0000287234MDP0000258116MDP0000174692MDP0000206503MDP0000556230
MDP0000471558MDP0000135450
Manihot esculentacassava4.1_009618mcassava4.1_009702mcassava4.1_010249mcassava4.1_033379mcassava4.1_010240m
cassava4.1_026309mcassava4.1_010674mcassava4.1_032721mcassava4.1_021555mcassava4.1_022331m
cassava4.1_030595mcassava4.1_030890mcassava4.1_027193mcassava4.1_030436mcassava4.1_032503m
cassava4.1_026722mcassava4.1_032455mcassava4.1_029613mcassava4.1_020917mcassava4.1_032261m
cassava4.1_033437mcassava4.1_030641mcassava4.1_023733m.346.625cassava4.1_023733m.346.625cassava4.1_021727m
cassava4.1_031624mcassava4.1_028252mcassava4.1_026328mcassava4.1_023733m.29.316cassava4.1_023733m.29.316
cassava4.1_029633mcassava4.1_030609mcassava4.1_033247mcassava4.1_027197mcassava4.1_022956m
cassava4.1_032034m
Medicago truncatulaMedtr8g102380.1Medtr5g012600.1Medtr5g095490.1Medtr7g092780.1Medtr1g086540.1
Medtr7g102600.1Medtr4g124740.1Medtr7g011530.1Medtr6g012800.1Medtr2g033970.1
Medtr5g088300.1Medtr5g088280.1Medtr5g088290.1Medtr4g051810.1Medtr5g093970.1
Medtr6g042690.1Medtr6g042660.1.176.362Medtr6g042660.1.176.362Medtr1g039640.1Medtr6g025590.1
Medtr4g130790.1
Mimulus guttatusmgv1a008262mmgv1a019910mmgv1a024695mmgv1a025960mmgv1a011822m
mgv1a022744mmgv1a008469mmgv1a008712mmgv1a007131mmgv1a018528m
mgv1a025315mmgv1a010310mmgv1a009526mmgv1a023562mmgv1a024891m
mgv1a008641mmgv1a011615mmgv1a025297mmgv1a021664m
Oryza sativaLOC_Os01g53990.1LOC_Os05g44600.1LOC_Os07g41650.1LOC_Os04g46740.1LOC_Os08g10604.1
LOC_Os12g37660.1LOC_Os11g45730.1LOC_Os01g53990.2LOC_Os11g45720.1LOC_Os09g39760.1
LOC_Os07g41650.2LOC_Os01g44340.1LOC_Os10g26680.1LOC_Os10g26680.2LOC_Os04g46740.2
LOC_Os03g19610.1LOC_Os01g19440.1LOC_Os07g46190.1LOC_Os11g43830.1
Panicum virgatumPavirv00013899mPavirv00048215mPavirv00050807mPavirv00024525mPavirv00040591m
Pavirv00051839mPavirv00005854mPavirv00036597mPavirv00029328mPavirv00035711m
Pavirv00007521mPavirv00063328mPavirv00016861mPavirv00044964mPavirv00028804m
Pavirv00052282mPavirv00001796mPavirv00038911mPavirv00046994mPavirv00038832m
Pavirv00010445mPavirv00046526mPavirv00070844mPavirv00006056mPavirv00059330m
Pavirv00050930mPavirv00020445m.93.240Pavirv00020445m.93.240Pavirv00040986mPavirv00060860m
Physcomitrella patensPp1s55_167V6.3Pp1s55_167V6.2Pp1s55_167V6.1Pp1s23_141V6.1Pp1s118_31V6.1
Pp1s67_89V6.4Pp1s67_89V6.3Pp1s67_89V6.2Pp1s67_89V6.1Pp1s45_249V6.1
Pp1s112_175V6.1Pp1s3_508V6.1Pp1s35_88V6.1Pp1s59_288V6.1Pp1s112_177V6.1
Pp1s175_19V6.1Pp1s215_36V6.1Pp1s198_26V6.1Pp1s35_24V6.1Pp1s81_236V6.1
Pp1s236_87V6.1Pp1s236_80V6.1Pp1s446_3V6.2Pp1s461_15V6.1Pp1s236_72V6.1
Pp1s227_9V6.1Pp1s67_157V6.1Pp1s67_6V6.1Pp1s129_155V6.1Pp1s341_66V6.1
Pp1s215_36V6.2Pp1s112_158V6.1Pp1s325_49V6.1Pp1s118_55V6.1Pp1s35_51V6.1
Pp1s236_72V6.2Pp1s14_353V6.1Pp1s215_36V6.3Pp1s446_3V6.1.92.256Pp1s446_3V6.1.92.256
Pp1s23_141V6.2
Phaseolus vulgarisPhvul.007G212000.1Phvul.004G175200.1Phvul.002G308000.1Phvul.002G063100.1Phvul.003G220500.1
Phvul.001G140600.1Phvul.001G183100.1Phvul.008G278000.2Phvul.008G278000.1Phvul.008G277900.1
Phvul.003G127700.1Phvul.008G039000.1Phvul.003G027000.1Phvul.008G271800.1Phvul.008G272000.1
Phvul.003G015600.1Phvul.008G271500.1Phvul.008G271600.1Phvul.003G015700.1Phvul.007G202000.1
Phvul.007G201900.1
Picea abiesMA_10428610g0010MA_14449g0010MA_20853g0010MA_28575g0010MA_181657g0020
MA_99816g0010MA_66089g0010MA_304854g0010MA_18312g0010MA_62865g0010
MA_6149868g0010MA_87592g0010MA_274107g0010MA_10267810g0010MA_10428610g0020
MA_112715g0010MA_40503g0010MA_101720g0010MA_6780346g0010MA_10434773g0030
MA_10428625g0010MA_10426622g0010MA_5097g0010MA_33008g0010MA_16389g0020
MA_19196g0010MA_98283g0010MA_10434773g0010
Populus trichocarpaPotri.018G068400.1Potri.014G117100.1Potri.007G015700.2Potri.007G015700.1Potri.003G076900.2
Potri.003G076900.1Potri.001G365700.1Potri.001G364200.1Potri.016G017700.1Potri.018G068400.3
Potri.006G120100.1Potri.004G156300.1Potri.006G137100.1Potri.003G076900.3Potri.003G076900.4
Potri.015G110700.1Potri.006G186100.1Potri.006G186000.1Potri.008G104800.1Potri.012G114900.1
Potri.012G112800.1Potri.T007200.1Potri.004G128900.1Potri.006G120100.2Potri.004G128900.2
Potri.004G128900.3Potri.017G087300.1Potri.005G012800.1Potri.018G068400.2Potri.012G115200.1
Potri.017G054700.1Potri.013G008100.1Potri.004G033700.1Potri.001G314600.1
Prunus persicappa007112mppa005976mppa023424mppa006779mppa023784m
ppa024139mppa007761mppa025119mppa027083mppa026550m
ppa021246mppa022374mppa017141mppa015611mppa007766m
ppa018812mppa007533mppa015184mppa019696mppa008873m
ppa026195mppb020245mppa020130mppa024066mppa017319m
ppa020682mppa019869mppa019999mppa024542mppa019857m
ppb015196mppb012738m
Ricinus communis28623.m00038929912.m00542629629.m00135630106.m00067729739.m003697
30131.m00704729916.m00052230147.m01436230078.m00222230147.m014363
29748.m00038029635.m00045228859.m00033030147.m01436130076.m004631.364.651
30076.m004631.364.65130147.m01436030076.m004631.38.33030076.m004631.38.33030071.m000430
30128.m00891929904.m00295430076.m004627
Setaria italicaSi004863mSi022230mSi030204mSi012719mSi024215m
Si015123mSi027980mSi039580mSi004149mSi036641m
Si019219mSi006799mSi004903mSi032068mSi005070m
Si004867mSi019694m
Selaginella moellendorffii101090769516566316509876693
104861815833494273566402675
16420210330577752
Sorghum bicolorSb09g026060.1Sb03g034250.1Sb06g024730.1Sb08g018360.1Sb07g006050.1
Sb02g012560.1Sb05g026816.1Sb04g031450.1Sb02g038910.1Sb01g022290.1
Sb03g028930.1Sb03g022950.1Sb03g012410.1Sb02g041430.1Sb02g041430.2
Sb04g037730.1
Thellungiella halophilaThhalv10013810mThhalv10000935mThhalv10009800mThhalv10013811mThhalv10015978m
Thhalv10000702mThhalv10005724mThhalv10004453mThhalv10013913mThhalv10013901m
Thhalv10021065mThhalv10023834mThhalv10002927mThhalv10001795mThhalv10029493m
Thhalv10005316m
Vitis viniferaGSVIVT01028170001GSVIVT01018823001GSVIVT01015290001GSVIVT01001327001GSVIVT01015852001
GSVIVT01033712001GSVIVT01015022001GSVIVT01014641001GSVIVT01009729001GSVIVT01023786001
GSVIVT01013838001GSVIVT01013839001GSVIVT01013827001GSVIVT01013832001GSVIVT01034985001
GSVIVT01011459001GSVIVT01000525001GSVIVT01031250001.248.534GSVIVT01031250001.248.534GSVIVT01031250001.56.207
GSVIVT01031250001.56.207
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)