y PlantCAZyme

CAZyme Information

Basic Information
SpeciesBrachypodium distachyon
Cazyme IDBradi4g07847.1
FamilyGH32
Protein PropertiesLength: 575 Molecular Weight: 62109.5 Isoelectric Point: 5.5718
ChromosomeChromosome/Scaffold: 4 Start: 6758072 End: 6760706
DescriptionGlycosyl hydrolases family 32 protein
View CDS
External Links
NCBI Taxonomy
Plaza
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GH32153410
  HFQPAKNWQNGPMYHNGMYHLFYQYNPHGPTWDAGKLSWGHSVSGDLVNWAALDNALDPTSPFDANGCWSGSATVLPGGRPAILYTGIDADRVQVQNVAF
  ASNPSDPLLRDWHKPSCNPVIGIPADVTGNNFRDPTEPWRGSDGLWRVAVAAEVEGKGTLLVYRSADFLRWERNPGPPLHASSPAVPVLECPDLFPISMA
  AAAEQEGLDALMAAGGSSSGGVTHVLKLTDFAKEDHYMVGRYDELAGDTFAPAEPERGDDPGRWRRLDHGHLYASKSFFDARKKRRVLWAWVDENDGAAE
  AKGWAGIQAFPRAMWLDGDGKGLVQWP
Full Sequence
Protein Sequence     Length: 575     Download
MDGTKNPQHG RTAYHFQPAK NWQNGPMYHN GMYHLFYQYN PHGPTWDAGK LSWGHSVSGD    60
LVNWAALDNA LDPTSPFDAN GCWSGSATVL PGGRPAILYT GIDADRVQVQ NVAFASNPSD    120
PLLRDWHKPS CNPVIGIPAD VTGNNFRDPT EPWRGSDGLW RVAVAAEVEG KGTLLVYRSA    180
DFLRWERNPG PPLHASSPAV PVLECPDLFP ISMAAAAEQE GLDALMAAGG SSSGGVTHVL    240
KLTDFAKEDH YMVGRYDELA GDTFAPAEPE RGDDPGRWRR LDHGHLYASK SFFDARKKRR    300
VLWAWVDEND GAAEAKGWAG IQAFPRAMWL DGDGKGLVQW PVEEIETLRR KRDSGFGPEG    360
TEVGAGGKVE IGAGIQSSQA DVEVVFEIPS LEEAETLDDL EWALDDPQRL CAEKGAFVHG    420
GVGPFGLLVL ASGGLQEHTA VFFRVFRHQG KYKVLMCTDL TRSSTKAGVN KPCYGAFLDV    480
DVEKDRSISL RTLIDHTVVE SFGNGGRTCM TARVYPEHAA KGRSRTYVFN HGAGAVKVSK    540
LEAWELAAAA VNGAGGGGGS VAPDVATVWS DFVI*                               600
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
TIGR01322scrB_fam1.0e-3710350365+
COG1621SacC2.0e-574522534+
cd08996GH32_B_Fructosidase3.0e-7624344328+
pfam00251Glyco_hydro_32N3.0e-10915341340+
smart00640Glyco_322.0e-13615506505+
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
Swiss-ProtA2YZ0101156340585INV7_ORYSI RecName: Full=Beta-fructofuranosidase, insoluble isoenzyme 7; AltName: Full=Sucrose hydrolase 7; AltName: Full=Invertase 7; AltName: Full=Cell wall beta-fructosidase 7; AltName: Full=OsCIN7; Flags: Precursor
GenBankAAD38399.101156340585AF155121_1 apoplastic invertase [Oryza sativa Indica Group]
DDBJBAD23559.101156340584putative apoplastic invertase [Oryza sativa Japonica Group]
EMBLCAH65976.1015544546H1005F08.5 [Oryza sativa (indica cultivar-group)]
GenBankEEC84182.101156339584hypothetical protein OsI_30564 [Oryza sativa Indica Group]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB2aey_A085495531B Chain B, Structural Basis Of Gibberellin(Ga3)-Induced Della Recognition By The Gibberellin Receptor
PDB2ade_A085495531B Chain B, Structural Basis Of Gibberellin(Ga3)-Induced Della Recognition By The Gibberellin Receptor
PDB2add_A085495531B Chain B, Structural Basis Of Gibberellin(Ga3)-Induced Della Recognition By The Gibberellin Receptor
PDB1st8_A085495531A Chain A, Crystal Structure Of Fructan 1-Exohydrolase Iia From Cichorium Intybus
PDB2aez_A085495531A Chain A, Crystal Structure Of Fructan 1-Exohydrolase Iia (E201q) From Cichorium Intybus In Complex With 1-Kestose
Metabolic Pathways
Pathway NameReactionECProtein Name
sucrose degradation IIIRXN-1461EC-3.2.1.26β-fructofuranosidase
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
EE5912024221295460
EE59120222312140
CT842376549115460
EG3984182692785430
HO1704082542805310
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_035_00225.2Aquca_035_00225.4Aquca_035_00225.3Aquca_035_00225.1Aquca_013_00697.8
Aquca_013_00697.7Aquca_013_00697.6Aquca_013_00697.5Aquca_013_00697.4Aquca_013_00697.3
Aquca_013_00697.1Aquca_013_00697.9Aquca_072_00084.1Aquca_035_00229.1Aquca_035_00226.4
Aquca_035_00226.3Aquca_035_00226.2Aquca_035_00226.1Aquca_035_00234.1Aquca_072_00084.3
Aquca_072_00084.4Aquca_072_00084.2Aquca_035_00234.2Aquca_035_00233.1Aquca_035_00232.2
Aquca_035_00232.1Aquca_072_00084.5Aquca_035_00232.5Aquca_035_00232.3Aquca_035_00232.4
Aquca_035_00229.2Aquca_013_00697.2Aquca_039_00169.1Aquca_035_00227.1
Arabidopsis lyrata478781875662888545341506474565
866669902730909164
Arabidopsis thalianaAT3G13790.2AT1G62660.1AT3G13790.1AT3G13784.1AT1G12240.1
AT1G55120.1AT3G52600.1AT2G36190.1AT5G11920.2AT5G11920.1
AT1G55120.3AT3G52600.2AT1G55120.2
Brachypodium distachyonBradi5g16900.1Bradi5g09430.1Bradi1g52210.1Bradi3g46600.1Bradi2g61830.1
Bradi1g09500.1Bradi3g00910.1Bradi5g09420.1Bradi3g44990.3Bradi3g44990.2
Bradi3g44990.1Bradi5g25270.1
Brassica rapaBra021508Bra027030Bra027397Bra019749Bra036653
Bra023053Bra037980Bra026984Bra033419Bra006129.19.344
Bra006129.19.344Bra027398Bra008926Bra017257Bra036652
Bra006129.551.689Bra006129.551.689
Carica papayaevm.model.supercontig_29.123evm.model.supercontig_3.313evm.model.supercontig_29.125evm.model.supercontig_104.108evm.model.supercontig_249.5
evm.model.supercontig_25.48
Capsella rubellaCarubv10013316mCarubv10019930mCarubv10019944mCarubv10019464mCarubv10022878m
Carubv10013339mCarubv10000634mCarubv10008754mCarubv10008995mCarubv10002713m
Chlamydomonas reinhardtiiCre12.g488000.t1.2Cre12.g488050.t1.2Cre12.g501900.t1.2Cre12.g507029.t1.2g14297.t1
Cre12.g501850.t1.3
Citrus clementinaCiclev10013701mCiclev10025259mCiclev10019134mCiclev10004465mCiclev10007827m
Ciclev10025243mCiclev10019787mCiclev10027399m
Citrus sinensisorange1.1g008189morange1.1g014220morange1.1g010428morange1.1g010409morange1.1g010183m
orange1.1g008242morange1.1g011094morange1.1g008224morange1.1g007810morange1.1g006523m
orange1.1g005279morange1.1g012546morange1.1g009698morange1.1g014058morange1.1g013412m
orange1.1g007857morange1.1g008686morange1.1g018161morange1.1g012389m
Cucumis sativusCucsa.166320.1Cucsa.241310.1Cucsa.360510.1Cucsa.302080.1Cucsa.360500.1
Cucsa.395090.1Cucsa.299460.1Cucsa.299460.2
Eucalyptus grandisEucgr.F03138.1Eucgr.D02029.1Eucgr.A02647.1Eucgr.A02888.1Eucgr.L03071.1
Eucgr.F03137.1Eucgr.C03053.2Eucgr.C03053.1Eucgr.C03054.1
Fragaria vescamrna21228.1-v1.0-hybridmrna32247.1-v1.0-hybridmrna23034.1-v1.0-hybridmrna15509.1-v1.0-hybridmrna23031.1-v1.0-hybrid
mrna06912.1-v1.0-hybridmrna15508.1-v1.0-hybrid
Glycine maxGlyma11g03360.1Glyma01g41990.1Glyma09g36580.2Glyma05g04290.4Glyma05g04290.2
Glyma05g04290.1Glyma17g14750.2Glyma17g14750.1Glyma06g47640.2Glyma13g42530.1
Glyma15g02850.1Glyma19g38160.1Glyma03g35520.1Glyma07g01090.1Glyma17g34590.3
Glyma17g34590.1Glyma14g11000.1Glyma12g00780.1Glyma10g08670.2Glyma08g20490.2
Glyma06g47640.3Glyma20g03620.1Glyma20g03620.2Glyma08g20480.2Glyma17g34570.1
Glyma17g34570.2Glyma08g20480.3Glyma14g10930.2Glyma20g03640.3Glyma20g03640.2
Glyma20g03580.2Glyma20g03553.2Glyma20g03553.1
Gossypium raimondiiGorai.008G236700.3Gorai.006G212600.2Gorai.006G212600.1Gorai.004G200800.1Gorai.008G236700.2
Gorai.008G236700.1Gorai.006G212600.5Gorai.008G216800.4Gorai.008G216800.2Gorai.003G114000.1
Gorai.006G153700.1Gorai.010G099300.2Gorai.010G099400.4Gorai.010G099400.3Gorai.010G099400.2
Gorai.010G099400.1Gorai.009G400500.1Gorai.008G216800.5Gorai.008G216800.1Gorai.003G059100.1
Gorai.008G216800.3Gorai.010G099300.3Gorai.010G099300.1Gorai.006G153700.3Gorai.006G153700.2
Gorai.011G064900.1Gorai.010G099400.5Gorai.013G220200.4Gorai.013G220200.2Gorai.010G099400.6
Gorai.013G220200.3Gorai.013G220200.1Gorai.006G212600.4Gorai.006G212600.3Gorai.008G236700.6
Gorai.008G236700.5Gorai.008G236700.4Gorai.008G216800.6Gorai.006G153800.1Gorai.002G238600.3
Gorai.002G238600.2Gorai.002G238600.1
Linum usitatissimumLus10004340Lus10028922Lus10032242Lus10031144Lus10024605
Lus10004031Lus10030278Lus10014217Lus10014219Lus10008392
Lus10021339Lus10015614Lus10017015Lus10037633Lus10037631
Lus10015613Lus10001529Lus10037632.53.227Lus10037632.53.227Lus10037632.228.407
Lus10037632.228.407
Malus domesticaMDP0000377084MDP0000149570MDP0000124776MDP0000275150MDP0000561738
MDP0000268052MDP0000166647
Manihot esculentacassava4.1_004675mcassava4.1_025414mcassava4.1_003183mcassava4.1_021742mcassava4.1_003482m
cassava4.1_004485mcassava4.1_004482mcassava4.1_021472mcassava4.1_021105mcassava4.1_034059m
Medicago truncatulaMedtr4g101630.1Medtr3g008530.1Medtr7g105050.1Medtr2g099950.1Medtr1g015910.1
Medtr5g066380.1Medtr1g015970.1Medtr1g015980.1Medtr1g015940.1
Mimulus guttatusmgv1a019992mmgv1a002627mmgv1a025972mmgv1a003330mmgv1a003306m
mgv1a003581mmgv1a004782mmgv1a003514m
Oryza sativaLOC_Os04g33720.1LOC_Os02g01590.1LOC_Os09g08072.1LOC_Os04g33740.1LOC_Os01g73580.1
LOC_Os02g01590.2LOC_Os04g56920.1LOC_Os04g45290.2LOC_Os04g45290.1LOC_Os04g56930.1
LOC_Os09g08120.1LOC_Os02g33110.2LOC_Os02g33110.1LOC_Os02g33110.3LOC_Os03g52560.1
Panicum virgatumPavirv00040801mPavirv00018816mPavirv00005120mPavirv00016669mPavirv00009422m
Pavirv00008825mPavirv00047450mPavirv00047030mPavirv00065306mPavirv00007399m
Pavirv00066494mPavirv00044424mPavirv00057395mPavirv00018481mPavirv00057396m
Pavirv00040343mPavirv00025851mPavirv00002869mPavirv00054063mPavirv00060573m
Pavirv00025084mPavirv00066262m
Physcomitrella patensPp1s18_302V6.1Pp1s66_29V6.1Pp1s177_28V6.5Pp1s177_28V6.4Pp1s177_28V6.3
Pp1s177_28V6.2Pp1s177_28V6.1Pp1s405_3V6.1Pp1s371_32V6.2Pp1s371_32V6.1
Pp1s51_338V6.1Pp1s238_23V6.1Pp1s238_22V6.1Pp1s37_120V6.1
Phaseolus vulgarisPhvul.011G005900.1Phvul.002G061200.1Phvul.005G008200.1Phvul.007G227200.1Phvul.010G137900.1
Phvul.005G158500.1Phvul.003G217900.1Phvul.001G036600.1Phvul.001G036800.1Phvul.001G191600.1
Phvul.010G137800.1Phvul.001G036700.3Phvul.001G036700.2Phvul.001G036700.1
Picea abiesMA_35999g0010MA_43229g0010MA_166367g0020MA_91461g0010MA_10426147g0010
MA_58418g0010MA_9901458g0010MA_883162g0010MA_64408g0010MA_25433g0010
MA_10380652g0010MA_111103g0010MA_111103g0020
Populus trichocarpaPotri.003G112600.7Potri.003G112600.6Potri.003G112600.5Potri.003G112600.4Potri.003G112600.2
Potri.003G112600.1Potri.015G127100.2Potri.015G127100.1Potri.006G210600.1Potri.003G126300.1
Potri.016G077400.2Potri.016G077400.1Potri.015G127100.3Potri.006G227500.3Potri.006G227500.2
Potri.006G227500.1Potri.006G227400.1Potri.016G077500.1Potri.003G112600.8Potri.003G112600.3
Prunus persicappa002732mppa002727mppa003470mppa002334mppa004378m
ppa003412mppa003343mppa019728mppa004218mppa022745m
Ricinus communis30147.m01421328200.m00019428629.m00056429706.m00135229706.m001354
28629.m000565
Setaria italicaSi012687mSi009702mSi009545mSi021569mSi000803m
Si009543mSi039535mSi009878mSi009687mSi016754m
Si009691mSi021617mSi025212mSi009988mSi016887m
Si025317m.131.271Si025317m.131.271
Selaginella moellendorffii1277932693869894931903
Sorghum bicolorSb06g023760.1Sb0067s002010.1Sb01g008910.1Sb03g047060.1Sb06g031910.1
Sb06g031930.1Sb04g021810.2Sb04g021810.1Sb06g031920.1Sb0067s002240.1
Sb04g021810.3Sb0067s002110.1Sb04g000620.1Sb0067s002130.1
Thellungiella halophilaThhalv10020376mThhalv10023331mThhalv10007016mThhalv10020395mThhalv10010231m
Thhalv10016415mThhalv10011339mThhalv10013192mThhalv10011380m
Vitis viniferaGSVIVT01016869001GSVIVT01018625001GSVIVT01001272001GSVIVT01035390001GSVIVT01035389001
GSVIVT01033873001GSVIVT01024570001GSVIVT01006154001
Volvox carteriVocar20014198mVocar20013968mVocar20000959m
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)