y PlantCAZyme

CAZyme Information

Basic Information
SpeciesBrachypodium distachyon
Cazyme IDBradi4g09920.1
FamilyGH1
Protein PropertiesLength: 652 Molecular Weight: 73161.8 Isoelectric Point: 6.0491
ChromosomeChromosome/Scaffold: 4 Start: 9378966 End: 9383315
DescriptionGlycosyl hydrolase superfamily protein
View CDS
External Links
NCBI Taxonomy
Plaza
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GH11675510
  SSGGDNCSHNVAAWHNVPNPQERLKFWSDPDTELKLAKETGISVFRMGVDWTRIMPKEPTEDLKSSVNYAALERYRWIIQQVRDHGMKVMLTLFHHSLPP
  WAGEYGGWKMEKTVNYFMDFVRLVVDRVSDLVDYWVVFNEPHVFVMLTYCAGSWPGGDPNALEVATSALPTGVYNQALHWMAVAHAEAYDYIHSESNNAM
  MPIVGVSHHVSFTRPYGLFDVAAVTIANSMTLFPYIDSICDKLDFIGINYYGQEVISGAGLKLVDNDEYSESGRGVYPDGLFRVLIKFNERYKSLDIPFI
  ITENGVSDETDLIRKPYILEHLLAIYAAILVGVRVLGYLFWTTSDNWEWADGYGPKFGLVAVDRANNLARKPRPSYYLFSKIVAT
Full Sequence
Protein Sequence     Length: 652     Download
MPWPAFLAAA VKLAVLAAAA ATAANAASYG RFRRRNLRRI ACPIDDSDDP VADFRALPLS    60
SSSAAADSED DEFFFGLATA PAHVEDRLED AWLQFATEHS CDDKEAMCDQ KPADAAMASA    120
GGDGGSQPAS RTTGVEKGAV GEQRKPLRVA MEAMLRGFEK FSDGGESSGG DNCSHNVAAW    180
HNVPNPQERL KFWSDPDTEL KLAKETGISV FRMGVDWTRI MPKEPTEDLK SSVNYAALER    240
YRWIIQQVRD HGMKVMLTLF HHSLPPWAGE YGGWKMEKTV NYFMDFVRLV VDRVSDLVDY    300
WVVFNEPHVF VMLTYCAGSW PGGDPNALEV ATSALPTGVY NQALHWMAVA HAEAYDYIHS    360
ESNNAMMPIV GVSHHVSFTR PYGLFDVAAV TIANSMTLFP YIDSICDKLD FIGINYYGQE    420
VISGAGLKLV DNDEYSESGR GVYPDGLFRV LIKFNERYKS LDIPFIITEN GVSDETDLIR    480
KPYILEHLLA IYAAILVGVR VLGYLFWTTS DNWEWADGYG PKFGLVAVDR ANNLARKPRP    540
SYYLFSKIVA TGKVTRQDRM SAWRELQQAA IQKKTRPFYR DVDKHGRMYA GGLDRPVQRN    600
FVLRDWRFGH YEMEGLQDPL SWFVRCITRP FSHKKKIHYI EDDTVSYSIS S*            660
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
PRK13511PRK135111.0e-18199554431+
TIGR01233lacG2.0e-19180529417+
TIGR03356BGL3.0e-43200545392+
pfam00232Glyco_hydro_13.0e-47197551416+
COG2723BglB6.0e-60200552409+
Gene Ontology
GO TermDescription
GO:0004553hydrolase activity, hydrolyzing O-glycosyl compounds
GO:0005975carbohydrate metabolic process
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankACF22735.1016511651beta-glycosidase [Brachypodium distachyon]
GenBankACL54550.104065040655unknown [Zea mays]
GenBankEAY81793.104065040646hypothetical protein OsI_36965 [Oryza sativa Indica Group]
RefSeqNP_001068463.104065040647Os11g0683500 [Oryza sativa (japonica cultivar-group)]
RefSeqNP_001105868.104065040657putative beta-glycosidase [Zea mays]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB3apg_D6e-3918655752460A Chain A, Crystal Structure Of Hyperthermophilic Beta-Glucosidase From Pyrococcus Furiosus
PDB3apg_C6e-3918655752460A Chain A, Crystal Structure Of Hyperthermophilic Beta-Glucosidase From Pyrococcus Furiosus
PDB3apg_B6e-3918655752460A Chain A, Crystal Structure Of Hyperthermophilic Beta-Glucosidase From Pyrococcus Furiosus
PDB3apg_A6e-3918655752460A Chain A, Crystal Structure Of Hyperthermophilic Beta-Glucosidase From Pyrococcus Furiosus
PDB4ha4_A1e-3818655753471A Chain A, Crystal Structure Of Hyperthermophilic Beta-Glucosidase From Pyrococcus Furiosus
Metabolic Pathways
Pathway NameReactionECProtein Name
lactose degradation IIIBETAGALACTOSID-RXNEC-3.2.1.23β-galactosidase
Transmembrane Domains
StartEnd
729
Signal Peptide
Cleavage Site
26
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
GO8386793223146350
GO8410083252135370
GO8544993312205500
GO8579233062265310
GO857923435315730.022
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_073_00022.2Aquca_073_00022.1Aquca_073_00022.3Aquca_073_00022.4
Arabidopsis lyrata477956
Arabidopsis thalianaAT3G06510.1AT3G06510.2
Brassica rapaBra040275Bra029584
Capsella rubellaCarubv10013225m
Citrus clementinaCiclev10004508mCiclev10004510mCiclev10004513mCiclev10004514mCiclev10004507m
Ciclev10004684m
Citrus sinensisorange1.1g008043m.64.291orange1.1g008043m.327.475orange1.1g008043m.327.475orange1.1g008043m.64.291orange1.1g008982m
orange1.1g006266morange1.1g006265morange1.1g006252morange1.1g006261morange1.1g011240m
orange1.1g008980m
Cucumis sativusCucsa.246950.2Cucsa.246950.1
Eucalyptus grandisEucgr.H04080.1Eucgr.H04080.2
Fragaria vescamrna05024.1-v1.0-hybrid
Glycine maxGlyma07g36470.2Glyma05g06465.1Glyma17g04130.1
Gossypium raimondiiGorai.006G080700.1Gorai.006G080700.2
Linum usitatissimumLus10043048Lus10011147
Malus domesticaMDP0000187687
Manihot esculentacassava4.1_003404m
Mimulus guttatusmgv1a023966m
Oryza sativaLOC_Os11g45710.1LOC_Os11g45710.2LOC_Os11g45710.3LOC_Os11g45710.4LOC_Os11g45710.5
LOC_Os11g45710.6LOC_Os11g45710.7
Panicum virgatumPavirv00063330mPavirv00063329mPavirv00005855m
Physcomitrella patensPp1s37_35V6.1Pp1s25_336V6.1
Phaseolus vulgarisPhvul.003G118100.1Phvul.003G118100.2
Picea abiesMA_36535g0010MA_10436797g0010MA_194231g0010MA_10111401g0010MA_7936147g0010
Populus trichocarpaPotri.010G149500.3Potri.010G149500.1Potri.010G149500.2
Prunus persicappa002585m
Ricinus communis29889.m003347.69.28529889.m003347.319.46729889.m003347.319.46729889.m003347.69.285
Setaria italicaSi026098mSi026096m
Selaginella moellendorffii110274935
Sorghum bicolorSb05g026810.3Sb05g026810.2Sb05g026810.1
Thellungiella halophilaThhalv10020302m
Vitis viniferaGSVIVT01034947001
Zea maysAC148152.3_FGT008
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny