y PlantCAZyme

CAZyme Information

Basic Information
SpeciesBrachypodium distachyon
Cazyme IDBradi4g11770.1
FamilyAA1
Protein PropertiesLength: 592 Molecular Weight: 65432.8 Isoelectric Point: 7.4378
ChromosomeChromosome/Scaffold: 4 Start: 11657609 End: 11659833
Descriptionlaccase 7
View CDS
External Links
NCBI Taxonomy
Plaza
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
AA1275700
  AAVVEHTFVVHEMNQTHLCNTTKIYVVNGQLPGPTIDVTDGDTVVVHVKNHLPHGLTIHWHGVRQIMSCWSDGAGFVTECPIPPGGEHTYRFNVTGQVGT
  LWWHAHVTCLRATVAGALVIRPKGNKYPFPTPAKDVPIIIGEWWELDLVELDRRMHDGNFDDNPLSATINGKLGDLSNCSGVPEESFVLDVVRGKTYLLR
  IINTALFSEYYFKVAGHALTVVGADGNYLTPYKTDMVTVAPGEAIDVLMVADAKPAQYHMVALANQPPEPDPQIPGFVSRGLVRYVGVPSNNNGMPVPTP
  LMPNQHNTMPSFYFHNNLTGLAHPDRHRVPMHVDERLFVTLGLGSICRNGSKTSCKRRRSNETIVVATMNNVSFHHLTKASLLESYYDGKPNKTLYTEDF
  PDNPPHPYNYTDRALIPPGPLEEALEPTFKATKLRRFKYNSSIEIVFQSTALLQSDSNPMHLHGYDFFVLAQGIGNFNPRTDPKRFNYHNPQLRNTVQVP
  RTGWAAIRFIADNPGIWYLHCHFEFHIIMGMATAFIVENGPTPE
Full Sequence
Protein Sequence     Length: 592     Download
MGKLSMATAI FCAVAVAVLT AAVGGKAAVV EHTFVVHEMN QTHLCNTTKI YVVNGQLPGP    60
TIDVTDGDTV VVHVKNHLPH GLTIHWHGVR QIMSCWSDGA GFVTECPIPP GGEHTYRFNV    120
TGQVGTLWWH AHVTCLRATV AGALVIRPKG NKYPFPTPAK DVPIIIGEWW ELDLVELDRR    180
MHDGNFDDNP LSATINGKLG DLSNCSGVPE ESFVLDVVRG KTYLLRIINT ALFSEYYFKV    240
AGHALTVVGA DGNYLTPYKT DMVTVAPGEA IDVLMVADAK PAQYHMVALA NQPPEPDPQI    300
PGFVSRGLVR YVGVPSNNNG MPVPTPLMPN QHNTMPSFYF HNNLTGLAHP DRHRVPMHVD    360
ERLFVTLGLG SICRNGSKTS CKRRRSNETI VVATMNNVSF HHLTKASLLE SYYDGKPNKT    420
LYTEDFPDNP PHPYNYTDRA LIPPGPLEEA LEPTFKATKL RRFKYNSSIE IVFQSTALLQ    480
SDSNPMHLHG YDFFVLAQGI GNFNPRTDPK RFNYHNPQLR NTVQVPRTGW AAIRFIADNP    540
GIWYLHCHFE FHIIMGMATA FIVENGPTPE TSLPPPPPEF KRCGANGLTR P*            600
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
TIGR03390ascorbOXfungal9.0e-4145565565+
PLN02191PLN021911.0e-6145562550+
PLN02604PLN026042.0e-6245561547+
TIGR03388ascorbase2.0e-7145561551+
TIGR03389laccase2.0e-17032566545+
Gene Ontology
GO TermDescription
GO:0005507copper ion binding
GO:0016491oxidoreductase activity
GO:0055114oxidation-reduction process
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
Swiss-ProtA2XCN602659128595LAC18_ORYSI RecName: Full=Putative laccase-18; AltName: Full=Benzenediol:oxygen oxidoreductase 18; AltName: Full=Urishiol oxidase 18; AltName: Full=Diphenol oxidase 18; Flags: Precursor
Swiss-ProtA2Y9C5015911590LAC19_ORYSI RecName: Full=Putative laccase-19; AltName: Full=Benzenediol:oxygen oxidoreductase 19; AltName: Full=Urishiol oxidase 19; AltName: Full=Diphenol oxidase 19; Flags: Precursor
RefSeqNP_001067650.1015911595Os11g0264000 [Oryza sativa (japonica cultivar-group)]
RefSeqNP_001068353.1015911590Os11g0641500 [Oryza sativa (japonica cultivar-group)]
RefSeqXP_002449914.1015911601hypothetical protein SORBIDRAFT_05g025570 [Sorghum bicolor]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB1asq_B04556119521A Chain A, Crystal Structure Of Galactosyltransferase Lgtc In Complex With Mn And Udp-2f-Galactose
PDB1asq_A04556119521A Chain A, Crystal Structure Of Galactosyltransferase Lgtc In Complex With Mn And Udp-2f-Galactose
PDB1asp_B04556119521A Chain A, Crystal Structure Of Galactosyltransferase Lgtc In Complex With Mn And Udp-2f-Galactose
PDB1asp_A04556119521A Chain A, Crystal Structure Of Galactosyltransferase Lgtc In Complex With Mn And Udp-2f-Galactose
PDB1aso_B04556119521A Chain A, Crystal Structure Of Galactosyltransferase Lgtc In Complex With Mn And Udp-2f-Galactose
Transmembrane Domains
StartEnd
729
Signal Peptide
Cleavage Site
27
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
EG3878332842755580
FL90458327812770
FE6275102503435920
FE6185152503415900
EG39188324912490
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_009_00804.1Aquca_009_00807.1Aquca_009_00807.2
Arabidopsis lyrata478237472269486975
Arabidopsis thalianaAT3G09220.1AT5G01040.1AT5G01050.1
Brachypodium distachyonBradi4g39330.1Bradi2g55050.1Bradi2g55060.1Bradi4g11827.1Bradi4g11850.1
Bradi3g45190.1Bradi1g10567.1Bradi3g22317.1Bradi4g11780.1Bradi4g11840.1
Bradi3g02290.1Bradi3g02300.1
Brassica rapaBra029753Bra028885Bra005699
Capsella rubellaCarubv10016347mCarubv10000548m
Glycine maxGlyma01g26750.1Glyma03g15800.5Glyma03g15805.1Glyma01g26750.2Glyma07g17170.1
Glyma18g41886.1Glyma18g41860.1Glyma07g17150.1Glyma18g41870.1
Malus domesticaMDP0000291183
Manihot esculentacassava4.1_006971m
Oryza sativaLOC_Os01g63200.1LOC_Os01g63190.1LOC_Os11g42200.1LOC_Os11g42220.1LOC_Os11g16260.1
LOC_Os10g20610.1
Panicum virgatumPavirv00040765mPavirv00049024mPavirv00038281mPavirv00007769mPavirv00063349m
Pavirv00062920mPavirv00053056mPavirv00047982mPavirv00069158mPavirv00051794m
Pavirv00019186mPavirv00057102mPavirv00039741mPavirv00033330mPavirv00023383m
Pavirv00050058mPavirv00043455mPavirv00033589mPavirv00032842mPavirv00018047m
Pavirv00032841mPavirv00054602mPavirv00028624mPavirv00051105mPavirv00056353m
Pavirv00054858mPavirv00054859m
Phaseolus vulgarisPhvul.010G005900.1Phvul.008G112100.1
Setaria italicaSi021601mSi020688mSi027309mSi021573mSi021628m
Si004353mSi000613mSi026121mSi028303mSi027928m
Si009653mSi026113mSi028115mSi027394mSi026118m
Si026123mSi026150mSi026109mSi028248mSi027660m
Si026140mSi027267mSi026136mSi027586mSi026159m
Si026153mSi026117mSi028198mSi026161mSi026162m
Si008101mSi026299mSi026376mSi026137mSi024846m
Si001570mSi001277mSi001174mSi027990m.20.264Si027990m.20.264
Si027990m.273.533Si027990m.273.533
Sorghum bicolorSb08g011530.1Sb03g039960.1Sb03g039980.1Sb03g039970.1Sb05g026630.1
Sb03g009410.1Sb05g025570.1Sb02g000300.1
Thellungiella halophilaThhalv10020392mThhalv10020388mThhalv10013097mThhalv10013058mThhalv10015329m
Zea maysAC234190.1_FGT002
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)