y PlantCAZyme

CAZyme Information

Basic Information
SpeciesBrachypodium distachyon
Cazyme IDBradi4g11850.1
FamilyAA1
Protein PropertiesLength: 610 Molecular Weight: 66877.4 Isoelectric Point: 6.1734
ChromosomeChromosome/Scaffold: 4 Start: 11717185 End: 11719839
Descriptionlaccase 7
View CDS
External Links
NCBI Taxonomy
Plaza
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
AA1235860
  AAVVEHTFVVSQVRMNRACKDTLVTVVNGQLPGPAIEVTEGDSVVVHVVNKSPHGLTIHWHGVKQRLNCWADGVGMITQCPIQPGKNFTYRFNVAGQEGT
  LWWHAHVASLRATVHGALIIRPRSGGDAGTLYPFPRPHKEVPIFIGEWWDVDLVELDMRMADGFFDDYPVNATINGMLGDLYDCAVHLCKSGYAGASEDI
  YVMQVEPGKTYMLRIVNVALLSRYYLKIAGHRFTVVAADANYVKPYNTDVIAIAPGESMDALVVADAPHGKYYMVALANQPPLPDQQIPVFSSRGVLQYS
  YNPIKGEDPTVINSLMVPEMPDQHDMMTSFYFHGNLTGATPHPPLPINVDDRLFISLALGSICRGSHVPLPSSPCRGYDVNESISVATMNNVSFQLPTKV
  SLLEAHYRGNMSIAGKLHELPDKPPTEYNYTDKTMIPWGSKEAALESTTKAMSVRMFRFNTTVEIVFQSTAILNSDANPMHLHGHDFFVLAQGLGNYDAE
  RDAGSYNLVDPPVRNTVLVPPVGWAAIRFVTDNPGVWFLHCHYGFHTSMGMAVAFEVENGQSSD
Full Sequence
Protein Sequence     Length: 610     Download
MALSPAAAVA VFFFLAMLVG GDAAVVEHTF VVSQVRMNRA CKDTLVTVVN GQLPGPAIEV    60
TEGDSVVVHV VNKSPHGLTI HWHGVKQRLN CWADGVGMIT QCPIQPGKNF TYRFNVAGQE    120
GTLWWHAHVA SLRATVHGAL IIRPRSGGDA GTLYPFPRPH KEVPIFIGEW WDVDLVELDM    180
RMADGFFDDY PVNATINGML GDLYDCAVHL CKSGYAGASE DIYVMQVEPG KTYMLRIVNV    240
ALLSRYYLKI AGHRFTVVAA DANYVKPYNT DVIAIAPGES MDALVVADAP HGKYYMVALA    300
NQPPLPDQQI PVFSSRGVLQ YSYNPIKGED PTVINSLMVP EMPDQHDMMT SFYFHGNLTG    360
ATPHPPLPIN VDDRLFISLA LGSICRGSHV PLPSSPCRGY DVNESISVAT MNNVSFQLPT    420
KVSLLEAHYR GNMSIAGKLH ELPDKPPTEY NYTDKTMIPW GSKEAALEST TKAMSVRMFR    480
FNTTVEIVFQ STAILNSDAN PMHLHGHDFF VLAQGLGNYD AERDAGSYNL VDPPVRNTVL    540
VPPVGWAAIR FVTDNPGVWF LHCHYGFHTS MGMAVAFEVE NGQSSDMTLP PPPIDLPRCE    600
HHGNSVAYQ*                                                           660
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
pfam07732Cu-oxidase_34.0e-4831147119+
PLN02604PLN026041.0e-7241578558+
PLN02191PLN021912.0e-8223577575+
TIGR03388ascorbase3.0e-9341578559+
TIGR03389laccase1.0e-18023599588+
Gene Ontology
GO TermDescription
GO:0005507copper ion binding
GO:0016491oxidoreductase activity
GO:0055114oxidation-reduction process
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
RefSeqNP_001064399.102759642599Os10g0346300 [Oryza sativa (japonica cultivar-group)]
RefSeqNP_001130676.102058223578hypothetical protein LOC100191779 [Zea mays]
RefSeqXP_002449914.1036054599hypothetical protein SORBIDRAFT_05g025570 [Sorghum bicolor]
RefSeqXP_002449982.102358229581hypothetical protein SORBIDRAFT_05g026630 [Sorghum bicolor]
RefSeqXP_002457562.101560120595hypothetical protein SORBIDRAFT_03g009410 [Sorghum bicolor]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB1asq_B04157719521A Chain A, Sugar Tongs Mutant S378p In Complex With Acarbose
PDB1asq_A04157719521A Chain A, Sugar Tongs Mutant S378p In Complex With Acarbose
PDB1asp_B04157719521A Chain A, Sugar Tongs Mutant S378p In Complex With Acarbose
PDB1asp_A04157719521A Chain A, Sugar Tongs Mutant S378p In Complex With Acarbose
PDB1aso_B04157719521A Chain A, Sugar Tongs Mutant S378p In Complex With Acarbose
Transmembrane Domains
StartEnd
726
Signal Peptide
Cleavage Site
23
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
EG387254263272890
HO797675535705990
HX190751259312890
DV532531246272710
EE591979624246040
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_009_00804.1Aquca_009_00807.1Aquca_009_00807.2
Arabidopsis lyrata478237472269486975
Arabidopsis thalianaAT3G09220.1AT5G01040.1AT5G01050.1
Brachypodium distachyonBradi4g39330.1Bradi2g55050.1Bradi2g55060.1Bradi4g11827.1Bradi3g45190.1
Bradi1g10567.1Bradi3g22317.1Bradi4g11780.1Bradi4g11770.1Bradi4g11840.1
Bradi3g02290.1Bradi3g02300.1
Brassica rapaBra029753Bra028885Bra005699
Capsella rubellaCarubv10016347mCarubv10000548m
Glycine maxGlyma01g26750.1Glyma03g15800.5Glyma03g15805.1Glyma01g26750.2Glyma07g17170.1
Glyma18g41886.1Glyma18g41860.1Glyma07g17150.1Glyma18g41870.1
Malus domesticaMDP0000291183
Manihot esculentacassava4.1_006971m
Oryza sativaLOC_Os01g63200.1LOC_Os01g63190.1LOC_Os11g42200.1LOC_Os11g42220.1LOC_Os11g16260.1
LOC_Os10g20610.1
Panicum virgatumPavirv00040765mPavirv00049024mPavirv00038281mPavirv00007769mPavirv00063349m
Pavirv00062920mPavirv00053056mPavirv00047982mPavirv00069158mPavirv00051794m
Pavirv00019186mPavirv00057102mPavirv00039741mPavirv00033330mPavirv00023383m
Pavirv00050058mPavirv00043455mPavirv00033589mPavirv00032842mPavirv00018047m
Pavirv00032841mPavirv00054602mPavirv00028624mPavirv00051105mPavirv00056353m
Pavirv00054858mPavirv00054859m
Phaseolus vulgarisPhvul.010G005900.1Phvul.008G112100.1
Setaria italicaSi021601mSi020688mSi027309mSi021573mSi021628m
Si004353mSi000613mSi026121mSi028303mSi027928m
Si009653mSi026113mSi028115mSi027394mSi026118m
Si026123mSi026150mSi026109mSi028248mSi027660m
Si026140mSi027267mSi026136mSi027586mSi026159m
Si026153mSi026117mSi028198mSi026161mSi026162m
Si008101mSi026299mSi026376mSi026137mSi024846m
Si001570mSi001277mSi001174mSi027990m.20.264Si027990m.20.264
Si027990m.273.533Si027990m.273.533
Sorghum bicolorSb08g011530.1Sb03g039960.1Sb03g039980.1Sb03g039970.1Sb05g026630.1
Sb03g009410.1Sb05g025570.1Sb02g000300.1
Thellungiella halophilaThhalv10020392mThhalv10020388mThhalv10013097mThhalv10013058mThhalv10015329m
Zea maysAC234190.1_FGT002
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)