y PlantCAZyme

CAZyme Information

Basic Information
SpeciesBrachypodium distachyon
Cazyme IDBradi4g21277.1
FamilyGH116
Protein PropertiesLength: 954 Molecular Weight: 106247 Isoelectric Point: 6.2201
ChromosomeChromosome/Scaffold: 4 Start: 24647063 End: 24658584
DescriptionBeta-glucosidase, GBA2 type family protein
View CDS
External Links
NCBI Taxonomy
Plaza
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GH1165328930
  GQFLYLEGIEYYMWNTYDVHFYASFALIMLFPKLQLSIQRDFAAAVMMHDPEKLKLLHDGKLAPRKVLGAVPHDLGLYDPWFKVNAYTLHNTDRWKDLNP
  KFVLQVYRDVVATGNKSFARAVWPSVYMAMAYMEQFDKDKDGMIENEDFPDQTYDVWSMAGVSAYCGGLWVAALQAASALAREVGDKASEELFWNKYEKA
  KSVYGKLWNGSYFNYDDAGTKVSTSIHADQLAGQWYAKSCGLSSIVDKDKSQSALEKIYSFNVMKFKDGKRGAMNGMWPDGTVDMSTMQSREIWPGVTYA
  LAASMIQEGMVEEGFKTAEGIYHAAWSPEGLGYAFQTPEAWTNDDGYRSLCYMRPLAIWSIQ
Full Sequence
Protein Sequence     Length: 954     Download
MKPNGMPEPP KGVSRNSSPS QTNGDSEKVD PGQLPELTWE HKLSHVRYDL PSFGLKWREA    60
VKMAGLGFRL GQHIVEETSK GRTAIIDPMK KRTAKSGQGV PLGGIGAGSI GRSYKGEFQR    120
WQLFPGACED KPVLANQFSA FISRQDGRKY STVLHPGKPD LPKGTNISGI GSWDWNLSGQ    180
KSTYHALYPR AWTVYDGEPD PDLKIVCRQV SPIIPHNYQQ SSYPAAVFTF TVANSGNTAV    240
DVTLLFTWAN SVGGKSELTG YHCNSSMLEK DGVHGILLHH RTADGQPPVT FAIAAQEKED    300
VHISECPYFV MSGSSDEFTA KDMWNSVKEH GSFDLLDPIE ASICSRPGTS IGAAIAASVK    360
LAPQSTKDVS FSLAWACPEV KFSSGKTYHR RYTKFYGTDV DAAASLAHDA IVDHSSWEKQ    420
IEEWQNPILQ DKRFPAWYPV TLFNELYYLN AGGSIWTDGL PPIQSLTAIG GKKFSLDMSN    480
GETDDVDEMI PHNNTATDIL QQMASILERI HASLASNSAI GTTLLQGEEN IGQFLYLEGI    540
EYYMWNTYDV HFYASFALIM LFPKLQLSIQ RDFAAAVMMH DPEKLKLLHD GKLAPRKVLG    600
AVPHDLGLYD PWFKVNAYTL HNTDRWKDLN PKFVLQVYRD VVATGNKSFA RAVWPSVYMA    660
MAYMEQFDKD KDGMIENEDF PDQTYDVWSM AGVSAYCGGL WVAALQAASA LAREVGDKAS    720
EELFWNKYEK AKSVYGKLWN GSYFNYDDAG TKVSTSIHAD QLAGQWYAKS CGLSSIVDKD    780
KSQSALEKIY SFNVMKFKDG KRGAMNGMWP DGTVDMSTMQ SREIWPGVTY ALAASMIQEG    840
MVEEGFKTAE GIYHAAWSPE GLGYAFQTPE AWTNDDGYRS LCYMRPLAIW SIQWALSSPK    900
LHKEPQRDLA QDSFPKNQFS YARIAKLLQL PEDESSKSFL QVIYEIVRNR FSS*          960
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
COG4354COG43542.0e-3399458375+
pfam12215GBA2_N2.0e-7299417327+
COG4354COG43545.0e-77531896385+
pfam04685DUF6081.0e-169532894367+
Gene Ontology
GO TermDescription
GO:0004348glucosylceramidase activity
GO:0006665sphingolipid metabolic process
GO:0016021integral to membrane
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankAAX95400.108295326931At5g49900 [Oryza sativa Japonica Group]
GenBankEEC67936.1019531950hypothetical protein OsI_35656 [Oryza sativa Indica Group]
RefSeqNP_001067588.1019531950Os11g0242100 [Oryza sativa (japonica cultivar-group)]
RefSeqXP_002264575.1019511947PREDICTED: hypothetical protein [Vitis vinifera]
RefSeqXP_002450573.1089538951hypothetical protein SORBIDRAFT_05g007160 [Sorghum bicolor]
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
GR3355472684357020
FF3541752824727520
CB6227322674216870
DY2920403595459000
CB6187132763346090
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_017_00087.2Aquca_017_00087.1Aquca_034_00116.1
Arabidopsis lyrata331392479911473529327181
Arabidopsis thalianaAT1G33700.2AT1G33700.1AT5G49900.1AT3G24180.2AT3G24180.1
AT4G10060.1
Brachypodium distachyonBradi3g28580.1Bradi3g13487.1Bradi1g28847.1Bradi3g13520.1
Brassica rapaBra014964Bra028008Bra000598Bra028320Bra033199
Carica papayaevm.model.supercontig_59.121evm.model.supercontig_21.79evm.model.supercontig_113.12
Capsella rubellaCarubv10025826mCarubv10012912mCarubv10008221mCarubv10002637m
Citrus clementinaCiclev10004255mCiclev10000199mCiclev10018743mCiclev10018742m
Citrus sinensisorange1.1g039165morange1.1g002202morange1.1g038924m
Cucumis sativusCucsa.266300.2Cucsa.266300.1Cucsa.023010.1Cucsa.237200.1Cucsa.237200.2
Eucalyptus grandisEucgr.I02786.1Eucgr.H02851.2Eucgr.H02851.1Eucgr.H00075.1Eucgr.F02980.1
Eucgr.F02980.2
Fragaria vescamrna29905.1-v1.0-hybridmrna02278.1-v1.0-hybrid
Glycine maxGlyma10g33610.1Glyma20g33990.1Glyma07g40310.2
Gossypium raimondiiGorai.008G046700.1Gorai.011G160300.5Gorai.011G160300.4Gorai.011G160300.3Gorai.011G160300.2
Gorai.011G160300.1Gorai.013G133800.2Gorai.013G133800.1Gorai.006G221200.3Gorai.006G221200.2
Gorai.006G221200.1Gorai.008G046700.3Gorai.008G046700.2.531.722Gorai.008G046700.2.531.722Gorai.008G046700.2.724.851
Gorai.008G046700.2.724.851
Linum usitatissimumLus10000757Lus10003517Lus10002950Lus10023340Lus10038471
Lus10038469
Malus domesticaMDP0000175141MDP0000220028MDP0000128604
Manihot esculentacassava4.1_001108mcassava4.1_002224mcassava4.1_003299mcassava4.1_005809m
Medicago truncatulaMedtr1g072720.1Medtr1g072680.1
Mimulus guttatusmgv1a000876mmgv1a000873m
Oryza sativaLOC_Os10g33420.1LOC_Os11g13810.1LOC_Os08g01940.2LOC_Os08g01940.1LOC_Os07g26210.1
LOC_Os07g26210.2
Panicum virgatumPavirv00047844mPavirv00042892mPavirv00041095mPavirv00002207mPavirv00050055m
Pavirv00014420mPavirv00035631mPavirv00038108m
Physcomitrella patensPp1s134_55V6.1Pp1s40_202V6.1
Phaseolus vulgarisPhvul.007G134300.1Phvul.003G075400.1
Picea abiesMA_10430605g0020MA_10431145g0020MA_61180g0010MA_35878g0010MA_10426003g0020.110.198
MA_10426003g0020.110.198MA_165077g0010
Populus trichocarpaPotri.T163400.1Potri.019G072800.2Potri.019G072800.1Potri.004G227200.4Potri.004G227200.2
Potri.004G227200.1Potri.003G178000.4Potri.003G178000.3Potri.003G178000.2Potri.003G178000.1
Potri.003G003400.1Potri.003G003400.2Potri.019G072800.3Potri.004G227200.3Potri.003G003400.3
Prunus persicappa001012mppa000954m
Ricinus communis29685.m00048429757.m00075229904.m002967
Setaria italicaSi034088mSi026057mSi025923mSi029270mSi028945m
Si028854mSi013210mSi026013m
Selaginella moellendorffii16663492385
Sorghum bicolorSb01g019510.2Sb01g019510.1Sb05g007160.1Sb0073s002050.1Sb07g001140.1
Thellungiella halophilaThhalv10006714mThhalv10012588mThhalv10020003mThhalv10020001m
Vitis viniferaGSVIVT01036381001GSVIVT01023217001
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)