y PlantCAZyme

CAZyme Information

Basic Information
SpeciesBrachypodium distachyon
Cazyme IDBradi4g27470.1
FamilyGT4
Protein PropertiesLength: 496 Molecular Weight: 54690.3 Isoelectric Point: 5.3276
ChromosomeChromosome/Scaffold: 4 Start: 32659420 End: 32661193
DescriptionUDP-Glycosyltransferase superfamily protein
View CDS
External Links
NCBI Taxonomy
Plaza
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GT42754528.4e-23
  NSKAKGFVFLSVYKWEQRKGWDVLLRAFLQEFSGADDVALYLLINAYHSDTDFSGKIHRFVKNSSIEEPVLGWAEVRVIDEHVPQSALPRLYKAADAFVL
  PSRGEGWGRPVVEAMAMELPVIVTNWSGPTEYLTEQNGYPLDVDRLTEVTEGPFKGHLCAEPSVEHLRGLMRLVFEDP
Full Sequence
Protein Sequence     Length: 496     Download
MPDSPPSQTP KPKPKRHLLV LLTAPSLLAV ALAVVFATST NPLPRLLHLL FRPSPSLLRP    60
PEPGPLADTS RDAAGRPPCV LWMAPFASGG GYCSEAWSYV ASLDANVAAD VGANFTLAIA    120
HHGDLESPEF WHGLPEQSKN LAYRLATAPC ELSRAVVVCH SEPGAWYPPM YESLPCPPTG    180
YDEPAFVIGR TMFETDRVSP EHVRRCNQMD AVWVPTDFHM STFVKSGVDP SKVVKVVQAV    240
DVTFFDPAKH VALPLPIGFS VMAPDDSDST WNTVNSKAKG FVFLSVYKWE QRKGWDVLLR    300
AFLQEFSGAD DVALYLLINA YHSDTDFSGK IHRFVKNSSI EEPVLGWAEV RVIDEHVPQS    360
ALPRLYKAAD AFVLPSRGEG WGRPVVEAMA MELPVIVTNW SGPTEYLTEQ NGYPLDVDRL    420
TEVTEGPFKG HLCAEPSVEH LRGLMRLVFE DPEEGRRKGR KAREDMAEKF SPEVVARIVA    480
DQIQQVLVST QQTDD*                                                    540
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
cd03809GT1_mtfB_like5.0e-15246399156+
pfam00534Glycos_transf_16.0e-17279422148+
cd03801GT1_YqgM_like3.0e-19277477209+
COG0438RfaG5.0e-21244487246+
cd03798GT1_wlbH_like2.0e-21244486245+
Gene Ontology
GO TermDescription
GO:0009058biosynthetic process
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankACG32958.10844956417glycosyl transferase, group 1 [Zea mays]
GenBankEEC84295.105349054488hypothetical protein OsI_30774 [Oryza sativa Indica Group]
RefSeqNP_001062800.105349053487Os09g0296700 [Oryza sativa (japonica cultivar-group)]
RefSeqNP_001137122.1024954499hypothetical protein LOC100217302 [Zea mays]
RefSeqXP_002462114.107349582500hypothetical protein SORBIDRAFT_02g019400 [Sorghum bicolor]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB2jjm_L0.0005331476256375A Chain A, Crystal Structure Of A Family Gt4 Glycosyltransferase From Bacillus Anthracis Orf Ba1558.
PDB2jjm_K0.0005331476256375A Chain A, Crystal Structure Of A Family Gt4 Glycosyltransferase From Bacillus Anthracis Orf Ba1558.
PDB2jjm_J0.0005331476256375A Chain A, Crystal Structure Of A Family Gt4 Glycosyltransferase From Bacillus Anthracis Orf Ba1558.
PDB2jjm_I0.0005331476256375A Chain A, Crystal Structure Of A Family Gt4 Glycosyltransferase From Bacillus Anthracis Orf Ba1558.
PDB2jjm_H0.0005331476256375A Chain A, Crystal Structure Of A Family Gt4 Glycosyltransferase From Bacillus Anthracis Orf Ba1558.
Transmembrane Domains
StartEnd
1739
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
GT8088202232734930
CJ6886312361684030
FF3625312032444460
EG3747442171073230
CA5962232141073200
Orthologous Group
SpeciesID
Citrus clementinaCiclev10015484m
Eucalyptus grandisEucgr.G02680.1
Oryza sativaLOC_Os09g12530.1
Panicum virgatumPavirv00055508m
Populus trichocarpaPotri.008G018200.1
Setaria italicaSi029608m
Sorghum bicolorSb02g019400.1
Vitis viniferaGSVIVT01034635001
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny