y PlantCAZyme

CAZyme Information

Basic Information
SpeciesBrachypodium distachyon
Cazyme IDBradi4g28210.1
FamilyGT1
Protein PropertiesLength: 494 Molecular Weight: 53139.6 Isoelectric Point: 4.6239
ChromosomeChromosome/Scaffold: 4 Start: 33538556 End: 33540223
DescriptionUDP-Glycosyltransferase superfamily protein
View CDS
External Links
NCBI Taxonomy
Plaza
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GT12664171.3e-33
  SQPAADAPRPSWMEWLDEKAASGRAVLYVALGTLALIPEAQLREVANGLERAEVDFIWAVRPANIELGLGFEERTMGRGLVVREWVDQPEILRHRSVKGF
  LSHCGWNSVLESVTAGVPLAVWPMQADQAFNARFVVDELKIAVRINTSDRTM
Full Sequence
Protein Sequence     Length: 494     Download
MASSDSNVLP HIAIFPFMAK GHTIPLIQLV HHLRRLATVT FFTTPGNAAF VREGLSVSGA    60
DDDTAAAVVE LVFPTDAPDI PRGVESAEGV TSMASFVSFV DAVSLLRPQL EASLAAMRPP    120
ASLFIADAFL YWANASAAAL GVPKVSFFGI SAFAQVMREL YYRHDPCGAA AVLRRGDVDG    180
DGNPTTFTVP EFPHIKLTFE DLMAPYGDDP SSAARMTELD GKLGKAIYGS QGLIVNTFHG    240
LEGPYMEFWN QQFGPTGWAV GPLCLSQPAA DAPRPSWMEW LDEKAASGRA VLYVALGTLA    300
LIPEAQLREV ANGLERAEVD FIWAVRPANI ELGLGFEERT MGRGLVVREW VDQPEILRHR    360
SVKGFLSHCG WNSVLESVTA GVPLAVWPMQ ADQAFNARFV VDELKIAVRI NTSDRTMRGL    420
VTSQEISEVV TELILGGMGA EAGKNAARLC VLAKEAVAEG GSSWKIVEEM IGGLCASKTE    480
TVFKESQEDP TDV*                                                      540
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
PLN02555PLN025552.0e-449484530+
PLN02448PLN024486.0e-502478501+
PLN02534PLN025343.0e-651463492+
PLN02863PLN028631.0e-681481505+
PLN03007PLN030072.0e-7411472497+
Gene Ontology
GO TermDescription
GO:0008152metabolic process
GO:0016758transferase activity, transferring hexosyl groups
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankEAZ08642.10947615496hypothetical protein OsI_30915 [Oryza sativa Indica Group]
GenBankEAZ08646.1014856490hypothetical protein OsI_30917 [Oryza sativa Indica Group]
RefSeqNP_001062897.1034769495Os09g0329200 [Oryza sativa (japonica cultivar-group)]
RefSeqNP_001062898.10934851391Os09g0329700 [Oryza sativa (japonica cultivar-group)]
RefSeqXP_002462233.10448910493hypothetical protein SORBIDRAFT_02g022230 [Sorghum bicolor]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB2pq6_A1e-3664715474A Chain A, Crystal Structure Of Medicago Truncatula Ugt85h2- Insights Into The Structural Basis Of A Multifunctional (Iso) Flavonoid Glycosyltransferase
PDB2vg8_A8e-35104657458A Chain A, Crystal Structure Of Medicago Truncatula Ugt85h2- Insights Into The Structural Basis Of A Multifunctional (Iso) Flavonoid Glycosyltransferase
PDB2vch_A8e-35104657458A Chain A, Crystal Structure Of Medicago Truncatula Ugt85h2- Insights Into The Structural Basis Of A Multifunctional (Iso) Flavonoid Glycosyltransferase
PDB2vce_A8e-35104657458A Chain A, Characterization And Engineering Of The Bifunctional N- And O-glucosyltransferase Involved In Xenobiotic Metabolism In Plants
PDB2c9z_A9e-33120463112439A Chain A, Characterization And Engineering Of The Bifunctional N- And O-glucosyltransferase Involved In Xenobiotic Metabolism In Plants
Metabolic Pathways
Pathway NameReactionECProtein Name
betacyanin biosynthesisRXN-8479EC-2.4.1betanidin 5-O-glucosyltransferase
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
CT85210635513490
EE17188525442550
HO1778842362554840
FL8829602451874280
BJ2799601961623530
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_025_00292.1Aquca_025_00293.1Aquca_002_00206.1Aquca_004_00007.1Aquca_004_00008.1
Aquca_004_00009.1Aquca_031_00060.1
Arabidopsis lyrata480568874994350625471154
Arabidopsis thalianaAT2G16890.2AT5G14860.1AT1G10400.1
Brachypodium distachyonBradi2g36325.1Bradi2g36297.1Bradi1g43760.1Bradi1g37120.1Bradi2g08147.1
Brassica rapaBra006271Bra008734Bra013043Bra018440
Capsella rubellaCarubv10013583mCarubv10003019mCarubv10013609mCarubv10016193mCarubv10012329m
Carubv10016195m
Citrus clementinaCiclev10015105m
Citrus sinensisorange1.1g019791morange1.1g048238m
Cucumis sativusCucsa.158560.1Cucsa.158600.1
Eucalyptus grandisEucgr.A01139.1Eucgr.J03156.1Eucgr.J03158.1Eucgr.J03155.1Eucgr.J03157.1
Eucgr.J03154.1
Fragaria vescamrna08733.1-v1.0-hybridmrna28389.1-v1.0-hybrid
Glycine maxGlyma16g08060.1
Gossypium raimondiiGorai.001G265200.1
Linum usitatissimumLus10022222Lus10022220Lus10022221Lus10026927Lus10026926
Lus10020124
Malus domesticaMDP0000575823MDP0000576836MDP0000159916MDP0000261158MDP0000296033
MDP0000800689MDP0000942526MDP0000691324MDP0000130487MDP0000203647
MDP0000865084
Manihot esculentacassava4.1_022533mcassava4.1_025192mcassava4.1_007045m
Mimulus guttatusmgv1a005626mmgv1a026899m
Oryza sativaLOC_Os06g39070.1LOC_Os09g16090.1LOC_Os09g16030.1LOC_Os09g21160.1LOC_Os04g24110.1
LOC_Os06g16000.1LOC_Os05g42040.1LOC_Os06g39080.1LOC_Os06g08830.1
Panicum virgatumPavirv00038352mPavirv00070294mPavirv00062203mPavirv00046074mPavirv00058520m
Pavirv00020575mPavirv00042658mPavirv00025139mPavirv00067592mPavirv00016340m
Pavirv00034420mPavirv00017568mPavirv00037090m
Physcomitrella patensPp1s15_417V6.2Pp1s15_417V6.1
Phaseolus vulgarisPhvul.007G048100.1Phvul.008G151900.1
Populus trichocarpaPotri.018G009000.1Potri.001G348100.1Potri.006G272600.1Potri.006G272500.2Potri.006G272500.1
Potri.018G008900.1Potri.005G036100.1
Prunus persicappa005107mppa023458mppa017646m
Ricinus communis29822.m00335529822.m003356
Setaria italicaSi033411mSi033010mSi006359mSi020900mSi006267m
Si006185m
Sorghum bicolorSb10g005950.1Sb02g022230.1Sb02g023640.1Sb02g023632.1Sb10g009810.1
Sb10g022980.1
Thellungiella halophilaThhalv10022679mThhalv10015356m
Vitis viniferaGSVIVT01016138001
Zea maysAC234524.1_FGT005
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)