y PlantCAZyme

CAZyme Information

Basic Information
SpeciesBrachypodium distachyon
Cazyme IDBradi4g28950.1
FamilyAA1
Protein PropertiesLength: 577 Molecular Weight: 63245.6 Isoelectric Point: 7.3954
ChromosomeChromosome/Scaffold: 4 Start: 34312321 End: 34316073
DescriptionCupredoxin superfamily protein
View CDS
External Links
NCBI Taxonomy
Plaza
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
AA13365563.09967e-42
  APTGPAWNDTAYRIAQSQATVSHPAHVHPPPPPRADRTILLLNSQNKIDGRIKWALNNVSFVLPHVPYLVSLKHGLRGTFDERPPPETYDNSTGYDVYGV
  QPNPNATTSDGLYRLAFGSVVDVVLQNANMLAPNNSETHPWHLHGHDFWVLGYGVGRYDPVAHPAAYNLKDPIMKNTVAVHPYGWTALRFRADNPGVWAF
  HCHIEAHFFMGMGVAFEEGID
AA1823490
  NVAIHWHGIRQIGTPWADGTEGVTQCPILPGETFEYRFVVDRPGTYMYHAHYGMQRSAGLNGMIIVSPAEPEPFSYDGEHDVFLNDWWHKSTYEQAAGLA
  SVPIEWVGEPKSLLINGRGRFNCSALAASGGAAAACNATSPDCAVQVFAVVPGRTYRFRIGSVTSLSALNFEIEGHPMTVVEADGHYVKPFVVKNLNIYS
  GETYSVLIKADQDPNRNYWLASNVVSRKPSTPTGTAVLSYYGGRSSPRALPPTAAPTGPAWNDTAYRI
Full Sequence
Protein Sequence     Length: 577     Download
MELLGANPRL LCCLFLCFFS SLAMSQAKTV HEKWDISYHF KSPDCVRKLA VTVNGGTPGP    60
TIRAAQGDTV VVTVKNSLMT ENVAIHWHGI RQIGTPWADG TEGVTQCPIL PGETFEYRFV    120
VDRPGTYMYH AHYGMQRSAG LNGMIIVSPA EPEPFSYDGE HDVFLNDWWH KSTYEQAAGL    180
ASVPIEWVGE PKSLLINGRG RFNCSALAAS GGAAAACNAT SPDCAVQVFA VVPGRTYRFR    240
IGSVTSLSAL NFEIEGHPMT VVEADGHYVK PFVVKNLNIY SGETYSVLIK ADQDPNRNYW    300
LASNVVSRKP STPTGTAVLS YYGGRSSPRA LPPTAAPTGP AWNDTAYRIA QSQATVSHPA    360
HVHPPPPPRA DRTILLLNSQ NKIDGRIKWA LNNVSFVLPH VPYLVSLKHG LRGTFDERPP    420
PETYDNSTGY DVYGVQPNPN ATTSDGLYRL AFGSVVDVVL QNANMLAPNN SETHPWHLHG    480
HDFWVLGYGV GRYDPVAHPA AYNLKDPIMK NTVAVHPYGW TALRFRADNP GVWAFHCHIE    540
AHFFMGMGVA FEEGIDRVGQ LPEEVMRCVS KKGGRH*                             600
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
TIGR03390ascorbOXfungal4.0e-8445554540+
TIGR03389laccase1.0e-10727566567+
TIGR03388ascorbase029570546+
PLN02604PLN02604024573552+
PLN02191PLN02191025568549+
Gene Ontology
GO TermDescription
GO:0005507copper ion binding
GO:0016491oxidoreductase activity
GO:0055114oxidation-reduction process
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankACN27982.103157428568unknown [Zea mays]
RefSeqNP_001063005.1035741576Os09g0365900 [Oryza sativa (japonica cultivar-group)]
RefSeqXP_002462284.1045741569hypothetical protein SORBIDRAFT_02g023140 [Sorghum bicolor]
RefSeqXP_002462285.102957425570hypothetical protein SORBIDRAFT_02g023150 [Sorghum bicolor]
RefSeqXP_002462286.102557431578hypothetical protein SORBIDRAFT_02g023160 [Sorghum bicolor]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB1asq_B0275681538A Chain A, Polygalacturonase From Erwinia Carotovora Ssp. Carotovora
PDB1asq_A0275681538A Chain A, Polygalacturonase From Erwinia Carotovora Ssp. Carotovora
PDB1asp_B0275681538A Chain A, Polygalacturonase From Erwinia Carotovora Ssp. Carotovora
PDB1asp_A0275681538A Chain A, Polygalacturonase From Erwinia Carotovora Ssp. Carotovora
PDB1aso_B0275681538A Chain A, Polygalacturonase From Erwinia Carotovora Ssp. Carotovora
Signal Peptide
Cleavage Site
27
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
EL420184280233000
DV7055153172425580
HO584787556365760
CK298807272262950
GR847295259643220
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_041_00052.1.82.339Aquca_041_00052.1.82.339Aquca_014_00555.1.62.334Aquca_014_00555.1.62.334Aquca_076_00041.2
Aquca_076_00041.1Aquca_041_00052.1.322.551Aquca_041_00052.1.322.551Aquca_014_00555.1.293.531Aquca_014_00555.1.293.531
Arabidopsis lyrata327935489021.76.330489021.76.330489021.332.543489021.332.543
Arabidopsis thalianaAT4G39830.1AT5G21100.1AT5G21105.3.93.349AT5G21105.3.93.349AT5G21105.1.93.348
AT5G21105.1.93.348AT5G21105.2AT5G21105.1.351.561AT5G21105.1.351.561AT5G21105.3.351.538
AT5G21105.3.351.538
Brachypodium distachyonBradi4g28950.1.82.349Bradi4g28950.1.82.349Bradi4g34690.1.66.371Bradi4g34690.1.66.371Bradi1g37600.1.101.397
Bradi1g37600.1.101.397Bradi1g37620.1.24.213Bradi1g37620.1.24.213Bradi4g28950.1.336.556Bradi4g28950.1.336.556
Bradi1g37620.1.300.552Bradi1g37620.1.300.552Bradi1g37600.1.396.616Bradi1g37600.1.396.616Bradi4g34690.1.374.560
Bradi4g34690.1.374.560
Brassica rapaBra021239Bra002357.76.340Bra002357.76.340Bra020145.76.334Bra020145.76.334
Bra040902.79.327Bra040902.79.327Bra002355.79.329Bra002355.79.329Bra040902.333.545
Bra040902.333.545Bra002357.331.550Bra002357.331.550Bra020145.312.543Bra020145.312.543
Bra002355.333.550Bra002355.333.550Bra002356
Carica papayaevm.model.supercontig_103.59.65.327evm.model.supercontig_103.59.65.327evm.model.supercontig_103.59.329.574evm.model.supercontig_103.59.329.574
Capsella rubellaCarubv10003529mCarubv10004461mCarubv10000569m.76.336Carubv10000569m.76.336Carubv10000578m.78.329
Carubv10000578m.78.329Carubv10000578m.287.554Carubv10000578m.287.554Carubv10000569m.338.548Carubv10000569m.338.548
Chlamydomonas reinhardtiiCre01.g031500.t1.2Cre02.g098350.t1.3
Citrus clementinaCiclev10014733mCiclev10025235m.97.370Ciclev10025235m.97.370Ciclev10025235m.335.568Ciclev10025235m.335.568
Citrus sinensisorange1.1g008038morange1.1g007890m.97.371orange1.1g007890m.97.371orange1.1g012467morange1.1g013385m
orange1.1g016150morange1.1g016030morange1.1g007890m.335.568orange1.1g007890m.335.568
Cucumis sativusCucsa.142840.1Cucsa.142830.1Cucsa.104600.1.63.324Cucsa.104600.1.63.324Cucsa.142810.1.299.517
Cucsa.142810.1.299.517Cucsa.104600.1.292.531Cucsa.104600.1.292.531
Eucalyptus grandisEucgr.B03781.1Eucgr.J00632.1Eucgr.I00388.1.75.347Eucgr.I00388.1.75.347Eucgr.I00451.1.64.318
Eucgr.I00451.1.64.318Eucgr.I00386.1.71.301Eucgr.I00386.1.71.301Eucgr.G00738.1.40.302Eucgr.G00738.1.40.302
Eucgr.I00360.1Eucgr.G00745.1Eucgr.I00451.1.277.518Eucgr.I00451.1.277.518Eucgr.I00388.1.301.548
Eucgr.I00388.1.301.548Eucgr.I00383.1Eucgr.I00385.1Eucgr.I00386.1.256.483Eucgr.I00386.1.256.483
Eucgr.G00738.1.290.505Eucgr.G00738.1.290.505Eucgr.I00361.1Eucgr.I00361.2
Fragaria vescamrna18497.1-v1.0-hybridmrna31737.1-v1.0-hybridmrna11056.1-v1.0-hybridmrna11055.1-v1.0-hybridmrna00542.1-v1.0-hybrid
Glycine maxGlyma14g04530.1Glyma20g12220.1Glyma13g03650.1Glyma20g12150.1Glyma05g33470.1.88.358
Glyma05g33470.1.88.358Glyma08g14730.1.90.352Glyma08g14730.1.90.352Glyma05g33470.1.354.553Glyma05g33470.1.354.553
Glyma08g14730.1.349.552Glyma08g14730.1.349.552
Gossypium raimondiiGorai.004G227900.1Gorai.008G103600.1Gorai.003G045100.1
Linum usitatissimumLus10009603Lus10016808Lus10000871.59.334Lus10000871.59.334Lus10022504.87.341
Lus10022504.87.341Lus10026753.80.305Lus10026753.80.305Lus10025538Lus10000871.318.529
Lus10000871.318.529Lus10026753.306.552Lus10026753.306.552Lus10022504.343.558Lus10022504.343.558
Malus domesticaMDP0000179298.35.319MDP0000179298.35.319MDP0000131142.89.323MDP0000131142.89.323MDP0000459146.40.262
MDP0000459146.40.262MDP0000125288.36.266MDP0000125288.36.266MDP0000125288.374.614MDP0000125288.374.614
MDP0000179298.298.525MDP0000179298.298.525MDP0000201304MDP0000568244MDP0000131142.325.559
MDP0000131142.325.559MDP0000459146.260.495MDP0000459146.260.495MDP0000920266.221.462MDP0000920266.221.462
Manihot esculentacassava4.1_029114m.82.347cassava4.1_029114m.82.347cassava4.1_003963m.155.371cassava4.1_003963m.155.371cassava4.1_004384m.36.226
cassava4.1_004384m.36.226cassava4.1_004384m.318.564cassava4.1_004384m.318.564cassava4.1_003963m.333.583cassava4.1_003963m.333.583
cassava4.1_029114m.300.548cassava4.1_029114m.300.548
Medicago truncatulaMedtr8g091390.1.86.341Medtr8g091390.1.86.341Medtr8g091390.1.315.552Medtr8g091390.1.315.552
Mimulus guttatusmgv1a003391m.33.225mgv1a003391m.33.225mgv1a003543mmgv1a003391m.335.562mgv1a003391m.335.562
mgv1a005649m.212.451mgv1a005649m.212.451
Oryza sativaLOC_Os06g37080.1LOC_Os09g20090.1.54.408LOC_Os09g20090.1.54.408LOC_Os09g32952.1LOC_Os06g37150.1.86.374
LOC_Os06g37150.1.86.374LOC_Os06g37150.1.379.598LOC_Os06g37150.1.379.598LOC_Os09g20090.1.316.555LOC_Os09g20090.1.316.555
Panicum virgatumPavirv00010476mPavirv00034691mPavirv00008852m.57.349Pavirv00008852m.57.349Pavirv00034692m
Pavirv00038723mPavirv00009193mPavirv00052126mPavirv00008852m.333.549Pavirv00008852m.333.549
Pavirv00027786mPavirv00058661m.257.479Pavirv00058661m.257.479
Physcomitrella patensPp1s308_11V6.1Pp1s1_590V6.1Pp1s144_8V6.1Pp1s194_194V6.1Pp1s60_109V6.1.84.354
Pp1s60_109V6.1.84.354Pp1s60_109V6.1.337.558Pp1s60_109V6.1.337.558
Phaseolus vulgarisPhvul.006G011700.1Phvul.006G011600.1Phvul.002G262200.1.79.351Phvul.002G262200.1.79.351Phvul.008G206900.1
Phvul.002G262200.1.338.549Phvul.002G262200.1.338.549
Picea abiesMA_19018g0010.88.322MA_19018g0010.88.322MA_10433807g0010MA_10431339g0010MA_10436713g0030.31.219
MA_10436713g0030.31.219MA_10436713g0030.228.409MA_10436713g0030.228.409MA_10436713g0010MA_19018g0010.319.548
MA_19018g0010.319.548MA_126229g0020MA_603008g0010.263.441MA_603008g0010.263.441MA_10128792g0010
Populus trichocarpaPotri.010G171700.1Potri.009G159700.1Potri.T079500.1Potri.005G079400.1.87.361Potri.005G079400.1.87.361
Potri.T079700.1.75.347Potri.T079700.1.75.347Potri.009G159700.2Potri.001G219300.2Potri.001G454700.1.90.354
Potri.001G454700.1.90.354Potri.007G088300.1Potri.001G219300.1Potri.T079700.1.300.544Potri.T079700.1.300.544
Potri.001G454700.1.344.552Potri.001G454700.1.344.552Potri.005G079400.1.337.560Potri.005G079400.1.337.560
Prunus persicappa003375mppa003411mppa005837mppa021554m
Ricinus communis29877.m00046929708.m000190
Setaria italicaSi006138mSi032784m.54.346Si032784m.54.346Si029363m.78.344Si029363m.78.344
Si003983m.82.360Si003983m.82.360Si006071m.87.371Si006071m.87.371Si015580m
Si029363m.324.547Si029363m.324.547Si032784m.326.546Si032784m.326.546Si006071m.368.591
Si006071m.368.591Si003983m.367.550Si003983m.367.550
Selaginella moellendorffii104957.46.417104957.46.417104957.368.570104957.368.570
Sorghum bicolorSb10g022430.1Sb10g022440.1.81.467Sb10g022440.1.81.467Sb02g023150.1.78.337Sb02g023150.1.78.337
Sb02g023140.1.79.351Sb02g023140.1.79.351Sb02g023160.1.88.358Sb02g023160.1.88.358Sb03g001450.1.79.370
Sb03g001450.1.79.370Sb02g023140.1.313.549Sb02g023140.1.313.549Sb02g023150.1.315.550Sb02g023150.1.315.550
Sb02g023160.1.346.558Sb02g023160.1.346.558Sb10g022440.1.382.605Sb10g022440.1.382.605Sb03g001450.1.355.568
Sb03g001450.1.355.568
Thellungiella halophilaThhalv10013093mThhalv10013113m.18.207Thhalv10013113m.18.207Thhalv10013113m.307.543Thhalv10013113m.307.543
Vitis viniferaGSVIVT01037479001GSVIVT01022165001GSVIVT01022172001GSVIVT01022168001GSVIVT01022181001
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)