y PlantCAZyme

CAZyme Information

Basic Information
SpeciesBrachypodium distachyon
Cazyme IDBradi4g30600.1
FamilyGT28
Protein PropertiesLength: 536 Molecular Weight: 57025.9 Isoelectric Point: 8.8968
ChromosomeChromosome/Scaffold: 4 Start: 36340526 End: 36345276
Descriptionmonogalactosyl diacylglycerol synthase 1
View CDS
External Links
NCBI Taxonomy
Plaza
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GT283525105.2e-31
  VLLMGGGEGMGPIEATARALDNALYDESLGEPMGQILVICGRNKKLASRLQSISWKVPVQVKGFVTKMEECMGACDCIITKAGPGTIAEAMIRGLPIILN
  GYIAGQEAGNVPYVVENGCGRFSKSPEHIAKIVADWFGPRSDELQVMSQNALKLARPDA
Full Sequence
Protein Sequence     Length: 536     Download
MPPPTASSLA AAADPALPAA FLSVPSPFLP SSATLPFAAA VAAPSHASFL PRARGGSRAL    60
AVSVSVTGPT STAASRLHHM WGEFARFVRL HGNQIAPLGF GSLGLAVGGG GGGGKADGNG    120
GGGGGGGADG VVEEDGMARA EAPKKVLILM SDTGGGHRAS AEAIKAAFAQ EFGDDYQVFV    180
TDLWTEHTPW PFNQLPRSYS FLVKHGPLWK MTYYGTAPRV IHQPHFAATS TFIAREVAKG    240
LMKYQPDVII SVHPLMQHVP LRVLRSRGLL DKIPFTTVIT DLSTCHPTWF HKLVTRCYCP    300
SAEVSKRALK AGLQPSQIKV YGLPVRPSFV KPVQPKDELR RELGMDEDLP AVLLMGGGEG    360
MGPIEATARA LDNALYDESL GEPMGQILVI CGRNKKLASR LQSISWKVPV QVKGFVTKME    420
ECMGACDCII TKAGPGTIAE AMIRGLPIIL NGYIAGQEAG NVPYVVENGC GRFSKSPEHI    480
AKIVADWFGP RSDELQVMSQ NALKLARPDA VFKIVHDLHE LVRQKSFVPQ YACAT*        540
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
COG0707MurG1.0e-27145515380+
PRK13608PRK136082.0e-33144532407+
PRK13609PRK136092.0e-44144521391+
pfam06925MGDG_synth4.0e-74157325169+
PLN02605PLN026050146525382+
Gene Ontology
GO TermDescription
GO:0005975carbohydrate metabolic process
GO:0009247glycolipid biosynthetic process
GO:0016758transferase activity, transferring hexosyl groups
GO:0030246carbohydrate binding
GO:0030259lipid glycosylation
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankACF84568.1015351529unknown [Zea mays]
EMBLCAN84152.107053563520hypothetical protein [Vitis vinifera]
RefSeqNP_001142118.1015351529hypothetical protein LOC100274282 [Zea mays]
Swiss-ProtQ69QJ707053569535MGDG1_ORYSJ RecName: Full=Probable monogalactosyldiacylglycerol synthase 1, chloroplastic; Short=OsMGD1; Flags: Precursor
RefSeqXP_002462401.1015351534hypothetical protein SORBIDRAFT_02g025070 [Sorghum bicolor]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB3s2u_A0.004398523227356A Chain A, Crystal Structure Of The Pseudomonas Aeruginosa Murg:udp-glcnac Substrate Comp
Metabolic Pathways
Pathway NameReactionECProtein Name
glycolipid biosynthesis2.4.1.46-RXNEC-2.4.1.46monogalactosyldiacylglycerol synthase
traumatin and (Z)-3-hexen-1-yl acetate biosynthesisHYDROHEX-RXN-13(S)-hydroperoxyoctadeca-9,11-dienoate lyase
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
GT0492283361895240
EX2679733421735140
CV5305402961404350
GO7960862872505360
HO4664773831425240
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_016_00340.4Aquca_016_00340.1Aquca_048_00001.3Aquca_048_00001.1Aquca_016_00340.2
Arabidopsis lyrata899522913288488950
Arabidopsis thalianaAT2G11810.1AT4G31780.2AT5G20410.1AT4G31780.1
Brachypodium distachyonBradi3g54387.1Bradi3g20020.1
Brassica rapaBra023984Bra011297Bra037199Bra020104
Carica papayaevm.model.supercontig_148.42evm.model.supercontig_277.14
Capsella rubellaCarubv10006327mCarubv10013637mCarubv10000862m
Chlamydomonas reinhardtiig14367.t1
Citrus clementinaCiclev10007936mCiclev10007956mCiclev10008213mCiclev10008083m
Citrus sinensisorange1.1g036427morange1.1g012492m
Cucumis sativusCucsa.162930.1Cucsa.132470.1
Eucalyptus grandisEucgr.C04035.1Eucgr.C00320.1Eucgr.C00495.1Eucgr.C04379.1Eucgr.C04035.2
Fragaria vescamrna14993.1-v1.0-hybridmrna31719.1-v1.0-hybridmrna30765.1-v1.0-hybrid
Glycine maxGlyma17g33780.1Glyma14g12120.1Glyma13g23150.1Glyma17g11720.1
Gossypium raimondiiGorai.010G119700.2Gorai.001G039100.1Gorai.010G119700.1Gorai.013G236200.1Gorai.009G014700.1
Gorai.009G014700.3
Linum usitatissimumLus10026895Lus10003418Lus10016359Lus10008048
Malus domesticaMDP0000135680MDP0000244574MDP0000214451MDP0000829982MDP0000305295
Manihot esculentacassava4.1_005396mcassava4.1_005397mcassava4.1_006812m
Medicago truncatulaMedtr4g115920.2Medtr4g115920.1
Mimulus guttatusmgv1a004593mmgv1a006191m
Oryza sativaLOC_Os09g25580.1LOC_Os02g55910.2LOC_Os02g55910.1LOC_Os08g20420.1LOC_Os08g20420.2
Panicum virgatumPavirv00042978mPavirv00044523mPavirv00010348mPavirv00051656mPavirv00029899m
Pavirv00008414mPavirv00051657m
Physcomitrella patensPp1s33_287V6.1Pp1s20_66V6.1
Phaseolus vulgarisPhvul.001G042600.1Phvul.003G171300.1
Picea abiesMA_5461g0010
Populus trichocarpaPotri.006G266500.1Potri.018G016600.1Potri.006G063300.3Potri.006G063300.2Potri.006G063300.1
Potri.018G123000.1Potri.006G266500.2
Prunus persicappa003927mppa006453m
Ricinus communis29848.m00450927394.m000347
Setaria italicaSi029462mSi016983mSi015030m
Selaginella moellendorffii271007
Sorghum bicolorSb02g025070.1Sb04g036240.1Sb07g027910.1
Thellungiella halophilaThhalv10024883mThhalv10022676mThhalv10013431m
Vitis viniferaGSVIVT01035995001GSVIVT01012838001
Volvox carteriVocar20009507m
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)