y PlantCAZyme

CAZyme Information

Basic Information
SpeciesBrachypodium distachyon
Cazyme IDBradi4g30950.1
FamilyGT31
Protein PropertiesLength: 321 Molecular Weight: 35826.2 Isoelectric Point: 7.0156
ChromosomeChromosome/Scaffold: 4 Start: 36714454 End: 36715532
DescriptionGalactosyltransferase family protein
View CDS
External Links
NCBI Taxonomy
Plaza
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GT31842531.9e-30
  ERRDIVRLAYALQPPVPAYARVDVRFVFCRVTDPTEATLVSLEEMQHGDIMVLDDSCAGENMNDGKTYAYISSVARLFAAAPYDYVMKTDDDTYLRVAAL
  VGELRGKPRDDAYLGYGYNMSGDPMLFMHGMGYVMSWDVATWVSTAAEILDRNDTLGPEDLMVGKWLNLA
Full Sequence
Protein Sequence     Length: 321     Download
MTMKTPSFSS YLLLAPLAIL FLVFLLPSLN RSSGSDGIGV LCNRRTGAAH HHHHTVVPPI    60
PAQAEPEPEL SLLVGILTMP KLRERRDIVR LAYALQPPVP AYARVDVRFV FCRVTDPTEA    120
TLVSLEEMQH GDIMVLDDSC AGENMNDGKT YAYISSVARL FAAAPYDYVM KTDDDTYLRV    180
AALVGELRGK PRDDAYLGYG YNMSGDPMLF MHGMGYVMSW DVATWVSTAA EILDRNDTLG    240
PEDLMVGKWL NLAGKGKNRY DLKPRMYDLN WGMDNFRPDT VAVHMLKDNR RWAAAFNYFN    300
VTAGIKQSSS SKLYHRLPLP *                                              360
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
PTZ00210PTZ002100.00714922884+
pfam01762Galactosyl_T5.0e-6122254163+
PLN03193PLN031933.0e-772250212+
Gene Ontology
GO TermDescription
GO:0006486protein glycosylation
GO:0008378galactosyltransferase activity
GO:0016020membrane
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankACN28027.1035309152433unknown [Zea mays]
RefSeqNP_001063243.103430639307Os09g0433000 [Oryza sativa (japonica cultivar-group)]
RefSeqNP_001132756.103231537316hypothetical protein LOC100194243 [Zea mays]
RefSeqNP_001136904.103530945326hypothetical protein LOC100217061 [Zea mays]
RefSeqXP_002462427.103231637324hypothetical protein SORBIDRAFT_02g025430 [Sorghum bicolor]
Transmembrane Domains
StartEnd
729
Signal Peptide
Cleavage Site
34
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
CB619209247703150
FL923311228702960
HX165149235813150
HX183513232843150
DV517758231703000
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_096_00011.1Aquca_096_00008.1Aquca_096_00010.1Aquca_002_01354.1
Arabidopsis lyrata918927
Arabidopsis thalianaAT5G57500.1
Brachypodium distachyonBradi3g60170.1Bradi2g15440.1Bradi2g15450.1Bradi2g15460.1Bradi2g17360.1
Bradi4g04430.1Bradi4g16710.1Bradi4g30940.1
Brassica rapaBra002724Bra006816
Carica papayaevm.model.supercontig_52.13
Capsella rubellaCarubv10026744m
Citrus clementinaCiclev10010309m
Citrus sinensisorange1.1g020721m
Cucumis sativusCucsa.092450.1
Eucalyptus grandisEucgr.C00164.1
Fragaria vescamrna04896.1-v1.0-hybridmrna05246.1-v1.0-hybridmrna04895.1-v1.0-hybrid
Glycine maxGlyma13g01060.1Glyma17g07150.1Glyma12g20860.1
Gossypium raimondiiGorai.004G100500.1
Linum usitatissimumLus10015527Lus10000372Lus10006963Lus10000407Lus10019998
Manihot esculentacassava4.1_024374m
Medicago truncatulaMedtr4g128310.1
Mimulus guttatusmgv1a025682mmgv1a018717mmgv1a021117m
Oryza sativaLOC_Os09g26330.1LOC_Os02g54390.1LOC_Os09g26320.1LOC_Os02g54370.1LOC_Os05g47880.1
LOC_Os02g54450.1LOC_Os09g26310.1LOC_Os09g26300.1LOC_Os06g09270.1LOC_Os02g54420.1
Panicum virgatumPavirv00040114mPavirv00020399mPavirv00061634mPavirv00009580mPavirv00040113m
Pavirv00047142mPavirv00009581mPavirv00040592mPavirv00020786mPavirv00027671m
Pavirv00062025mPavirv00047141mPavirv00070843m
Physcomitrella patensPp1s111_120V6.1Pp1s111_120V6.2Pp1s111_120V6.3Pp1s121_91V6.1
Phaseolus vulgarisPhvul.003G146700.1
Picea abiesMA_877072g0010MA_119164g0010MA_118743g0010
Populus trichocarpaPotri.007G131000.1Potri.018G094000.1
Prunus persicappa015950mppa025342mppa022137m
Setaria italicaSi030530mSi019701mSi030596mSi022442mSi019638m
Si008283m
Sorghum bicolorSb09g027700.1Sb04g035240.1Sb02g025430.1Sb10g006180.1Sb04g035250.1
Sb02g025420.1
Thellungiella halophilaThhalv10014129m
Vitis viniferaGSVIVT01038267001GSVIVT01029188001GSVIVT01029189001
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)