y PlantCAZyme

CAZyme Information

Basic Information
SpeciesBrachypodium distachyon
Cazyme IDBradi4g32810.1
FamilyAA2
Protein PropertiesLength: 350 Molecular Weight: 37868 Isoelectric Point: 5.425
ChromosomeChromosome/Scaffold: 4 Start: 38555650 End: 38558679
DescriptionPeroxidase superfamily protein
View CDS
External Links
NCBI Taxonomy
Plaza
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
AA2583140
  REPRSVASVMRLQFHDCFVNGCDGSVLMDATPTVPGEKEALSNINSLRSFEVVDQVKEALEEHCPGVVSCADIIVMASRDAVVLTGGPRWDVRLGREDSL
  TASQEDSDNIMPSPRANASTLIRLFAGYNLTITDLVALSGSHSIGQARCFSIVFRLYNQSGSGRPDPHMDPAYRAKLDALCPLGGDEEVTGGMDATPIVF
  DNQYFKDLVHLRGFLNSDQTLFSDNAGTRQVVAKFSEDQDAFFRAFADGMVKMGELQ
Full Sequence
Protein Sequence     Length: 350     Download
MAHPRGGVCP LLSLAVSLAL LCGGADAALR ELEVGYYART CPGAEEIVRG VMARALSREP    60
RSVASVMRLQ FHDCFVNGCD GSVLMDATPT VPGEKEALSN INSLRSFEVV DQVKEALEEH    120
CPGVVSCADI IVMASRDAVV LTGGPRWDVR LGREDSLTAS QEDSDNIMPS PRANASTLIR    180
LFAGYNLTIT DLVALSGSHS IGQARCFSIV FRLYNQSGSG RPDPHMDPAY RAKLDALCPL    240
GGDEEVTGGM DATPIVFDNQ YFKDLVHLRG FLNSDQTLFS DNAGTRQVVA KFSEDQDAFF    300
RAFADGMVKM GELQNPRKGE IRRNCRVANG SPSPRHKQVL LVQSLVQDY*               360
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
cd00314plant_peroxidase_like7.0e-3146312296+
pfam00141peroxidase6.0e-5848201154+
PLN03030PLN030302.0e-6934329304+
cd00693secretory_peroxidase2.0e-15331327300+
Gene Ontology
GO TermDescription
GO:0004601peroxidase activity
GO:0006979response to oxidative stress
GO:0020037heme binding
GO:0055114oxidation-reduction process
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankAAW52721.102633922335peroxidase 7 [Triticum monococcum]
GenBankACN25399.1013351334unknown [Zea mays]
RefSeqNP_001063439.102334631355Os09g0471100 [Oryza sativa (japonica cultivar-group)]
RefSeqNP_001148794.1013351334LOC100282411 [Zea mays]
RefSeqXP_002462523.1013351336hypothetical protein SORBIDRAFT_02g027330 [Sorghum bicolor]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB1qgj_B0313291299A Chain A, Arabidopsis Thaliana Peroxidase N
PDB1qgj_A0313291299A Chain A, Arabidopsis Thaliana Peroxidase N
PDB1qo4_A0313312306A Chain A, Arabidopsis Thaliana Peroxidase N
PDB1pa2_A0313312306A Chain A, Arabidopsis Thaliana Peroxidase A2
PDB4a5g_B0313313307A Chain A, Raphanus Sativus Anionic Peroxidase.
Metabolic Pathways
Pathway NameReactionECProtein Name
betanidin degradationRXN-8635EC-1.11.1.7peroxidase
Transmembrane Domains
StartEnd
729
Signal Peptide
Cleavage Site
27
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
DR432277310303390
DR970295289303180
DT942810256302850
HO778472303313330
CU566826273413130
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_010_00140.1
Arabidopsis lyrata481103
Arabidopsis thalianaAT2G22420.1
Brachypodium distachyonBradi4g32800.1
Brassica rapaBra030241Bra038526
Carica papayaevm.model.supercontig_55.82
Capsella rubellaCarubv10006362mCarubv10005220mCarubv10024601m
Citrus clementinaCiclev10026321mCiclev10026073m
Citrus sinensisorange1.1g020412m
Cucumis sativusCucsa.093730.2Cucsa.093730.1
Fragaria vescamrna16250.1-v1.0-hybridmrna16249.1-v1.0-hybrid
Glycine maxGlyma09g00480.1Glyma12g37060.2Glyma12g37060.1
Gossypium raimondiiGorai.007G234600.1Gorai.008G090200.1
Linum usitatissimumLus10035925
Manihot esculentacassava4.1_011704mcassava4.1_022224m
Medicago truncatulaMedtr4g031060.1Medtr4g030890.1Medtr4g031140.1
Mimulus guttatusmgv1a009760m
Oryza sativaLOC_Os09g29490.1
Panicum virgatumPavirv00052841m
Physcomitrella patensPp1s26_77V6.1
Phaseolus vulgarisPhvul.011G216300.1
Picea abiesMA_37159g0010MA_480797g0010
Populus trichocarpaPotri.005G072800.1Potri.007G096200.1
Prunus persicappa008728mppa018671mppa008698m
Ricinus communis29772.m000315
Setaria italicaSi030393m
Selaginella moellendorffii40341088102
Sorghum bicolorSb02g027330.1
Thellungiella halophilaThhalv10000239mThhalv10000442m
Vitis viniferaGSVIVT01003417001
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny