y PlantCAZyme

CAZyme Information

Basic Information
SpeciesBrachypodium distachyon
Cazyme IDBradi4g33660.1
FamilyGH28
Protein PropertiesLength: 462 Molecular Weight: 50387.9 Isoelectric Point: 6.4307
ChromosomeChromosome/Scaffold: 4 Start: 39367236 End: 39369768
DescriptionPectin lyase-like superfamily protein
View CDS
External Links
NCBI Taxonomy
Plaza
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GH28543860
  AVNACAAAGGGRVLLPAPGDYLTATVHLRSGVVLDVPPGARLLGGTRQGDYPPESRRWYVVLAENTTGAGVAGGGEINGQGGAFVVTPSDQKNIMVSWNT
  TGDCEGDECRPRLVGFIDSKDVRIHDITLNQPAYWCLHLVRCDNSVIRNVSIYGDFDTPNNDGIDIEDSNNTVITDCHIDTGDDAICPKSSTGPVYNLTA
  TNCWIRTKSCAIKFGSASFFNFERLLFDNITIVDAHRGLGMQIRDGGNVSDVMFSNIKMRTRYYHPSWWGRAEPIYITTCPRHPGYKEGTISDVRFINIS
  SVSENGVFLAGSRHGLLRNLKFENVDLTYKRWT
Full Sequence
Protein Sequence     Length: 462     Download
MALSPLLLAA VSVLLLLPPP QAAQSAASPR VFSVVDYGAA GDGARYDTAA IQAAVNACAA    60
AGGGRVLLPA PGDYLTATVH LRSGVVLDVP PGARLLGGTR QGDYPPESRR WYVVLAENTT    120
GAGVAGGGEI NGQGGAFVVT PSDQKNIMVS WNTTGDCEGD ECRPRLVGFI DSKDVRIHDI    180
TLNQPAYWCL HLVRCDNSVI RNVSIYGDFD TPNNDGIDIE DSNNTVITDC HIDTGDDAIC    240
PKSSTGPVYN LTATNCWIRT KSCAIKFGSA SFFNFERLLF DNITIVDAHR GLGMQIRDGG    300
NVSDVMFSNI KMRTRYYHPS WWGRAEPIYI TTCPRHPGYK EGTISDVRFI NISSVSENGV    360
FLAGSRHGLL RNLKFENVDL TYKRWTNYTG GLYDYRPGCQ EMVKHRTGGM MLEHISGLEI    420
DNVKMRWSKG SLKGWDVNPL LFRPSTIDGL SFHDWQSLDV Q*                       480
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
PLN03003PLN030034.0e-816325694+
PLN02155PLN021553.0e-8159389253+
PLN02188PLN021888.0e-10164383236+
pfam00295Glyco_hydro_283.0e-14164382238+
COG5434PGU18.0e-3530313318+
Gene Ontology
GO TermDescription
GO:0004650polygalacturonase activity
GO:0005975carbohydrate metabolic process
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankEEC84787.103046025455hypothetical protein OsI_31840 [Oryza sativa Indica Group]
GenBankEEE69946.103046025454hypothetical protein OsJ_29824 [Oryza sativa Japonica Group]
RefSeqNP_001063526.103046025450Os09g0487600 [Oryza sativa (japonica cultivar-group)]
RefSeqNP_001148969.102846124457polygalacturonase [Zea mays]
RefSeqXP_002462564.103046131462hypothetical protein SORBIDRAFT_02g028280 [Sorghum bicolor]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB3jur_D3e-183037426382A Chain A, The Crystal Structure Of A Hyperthermoactive Exopolygalacturonase From Thermotoga Maritima
PDB3jur_C3e-183037426382A Chain A, The Crystal Structure Of A Hyperthermoactive Exopolygalacturonase From Thermotoga Maritima
PDB3jur_B3e-183037426382A Chain A, The Crystal Structure Of A Hyperthermoactive Exopolygalacturonase From Thermotoga Maritima
PDB3jur_A3e-183037426382A Chain A, The Crystal Structure Of A Hyperthermoactive Exopolygalacturonase From Thermotoga Maritima
PDB2uvf_B0.00000000000000114313139488A Chain A, The Crystal Structure Of A Hyperthermoactive Exopolygalacturonase From Thermotoga Maritima
Signal Peptide
Cleavage Site
22
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
GT8323882572064620
CB6788562701534220
BQ5788702501664150
HO1626452392244620
GT8445492491654130
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_014_00836.1
Arabidopsis lyrata324272
Arabidopsis thalianaAT3G57790.1
Brassica rapaBra035299
Carica papayaevm.TU.contig_34124.1
Capsella rubellaCarubv10019007m
Chlamydomonas reinhardtiiCre12.g556350.t1.3
Citrus clementinaCiclev10005155mCiclev10004869m
Citrus sinensisorange1.1g038762m
Cucumis sativusCucsa.242950.1
Eucalyptus grandisEucgr.K01816.4Eucgr.K01816.1Eucgr.K01816.3Eucgr.K01816.2
Fragaria vescamrna00558.1-v1.0-hybrid
Glycine maxGlyma19g32550.1
Gossypium raimondiiGorai.006G139700.1
Linum usitatissimumLus10026318Lus10042350
Malus domesticaMDP0000248311
Manihot esculentacassava4.1_024146m
Medicago truncatulaMedtr7g092470.1
Mimulus guttatusmgv1a005515m
Oryza sativaLOC_Os09g31270.1
Panicum virgatumPavirv00061210mPavirv00068607m
Physcomitrella patensPp1s116_9V6.1Pp1s375_23V6.1
Phaseolus vulgarisPhvul.001G138000.1
Populus trichocarpaPotri.016G051200.1
Prunus persicappa005960m
Ricinus communis27810.m000670
Setaria italicaSi029777m
Selaginella moellendorffii437695105243
Sorghum bicolorSb02g028280.1
Thellungiella halophilaThhalv10005936m
Vitis viniferaGSVIVT01033349001
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny