y PlantCAZyme

CAZyme Information

Basic Information
SpeciesBrachypodium distachyon
Cazyme IDBradi4g34040.1
FamilyGH19
Protein PropertiesLength: 327 Molecular Weight: 36254.4 Isoelectric Point: 8.1396
ChromosomeChromosome/Scaffold: 4 Start: 39700495 End: 39702439
DescriptionChitinase family protein
View CDS
External Links
NCBI Taxonomy
Plaza
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GH19653060
  ISDFFKVYQFENLFAKRNTPIAKAVGFWDYQSFITASIPFQPQGFCTTGGKDMQMMELCAFLGHVGAKTSCGFGVATGGPTAWGLCYNREMSPEGIYCDD
  TYTQYPCVKGAEYYGRGAITVYWNYNYGAAGDGIKEDLLHHPEYLEQNATLAFQAAMWRWMTPIKKNQPSAHDAFVGNWKPTKNDTLSKRLPGFGATMNL
  LYGESICGRGFIDEMNVIISHYQYYLDLMGFGRERSGLNLDC
Full Sequence
Protein Sequence     Length: 327     Download
MKRKTRNKIV VTVLLVGAAA VLVGGTLALI LTAGTWKMKV KEAHEKVCSK GWECSNSKYC    60
CNQTISDFFK VYQFENLFAK RNTPIAKAVG FWDYQSFITA SIPFQPQGFC TTGGKDMQMM    120
ELCAFLGHVG AKTSCGFGVA TGGPTAWGLC YNREMSPEGI YCDDTYTQYP CVKGAEYYGR    180
GAITVYWNYN YGAAGDGIKE DLLHHPEYLE QNATLAFQAA MWRWMTPIKK NQPSAHDAFV    240
GNWKPTKNDT LSKRLPGFGA TMNLLYGESI CGRGFIDEMN VIISHYQYYL DLMGFGRERS    300
GLNLDCAEQA PFNPTTKKAD DQQPSG*                                        360
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
cd00442lysozyme_like0.000316523574+
pfam00182Glyco_hydro_195.0e-6073306234+
cd00325chitinase_glyco_hydro_191.0e-8769306238+
Gene Ontology
GO TermDescription
GO:0004568chitinase activity
GO:0006032chitin catabolic process
GO:0016998cell wall macromolecule catabolic process
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
DDBJBAI63079.104031924303putative chitinase [Epipremnum aureum]
RefSeqNP_001063549.1013231323Os09g0494200 [Oryza sativa (japonica cultivar-group)]
RefSeqNP_001142334.1013231323hypothetical protein LOC100274504 [Zea mays]
RefSeqXP_002460464.1013231323hypothetical protein SORBIDRAFT_02g028770 [Sorghum bicolor]
RefSeqXP_002515664.1013151313chitinase, putative [Ricinus communis]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB3cql_B0653122242A Chain A, Crystal Structure Of Gh Family 19 Chitinase From Carica Papaya
PDB3cql_A0653122242A Chain A, Crystal Structure Of Gh Family 19 Chitinase From Carica Papaya
PDB1cns_B0643121242A Chain A, Crystal Structure Of Chitinase At 1.91a Resolution
PDB1cns_A0643121242A Chain A, Crystal Structure Of Chitinase At 1.91a Resolution
PDB4dyg_B0643122243A Chain A, Crystal Structure Of Chitinase At 1.91a Resolution
Metabolic Pathways
Pathway NameReactionECProtein Name
chitin degradation II3.2.1.14-RXNEC-3.2.1.14chitinase
chitin degradation IIRXN-12623EC-3.2.1.14chitinase
chitin degradation IIRXN-12624EC-3.2.1.14chitinase
chitin degradation III (carnivorous plants)3.2.1.14-RXNEC-3.2.1.14chitinase
Transmembrane Domains
StartEnd
931
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
EG389636274533260
EE034281251733230
DT338715281393190
HO809991274423150
HO852027274423150
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_001_00867.1Aquca_001_00868.1Aquca_003_00268.1Aquca_015_00468.1Aquca_015_00466.1
Aquca_011_00480.1Aquca_017_00017.2Aquca_017_00017.1
Arabidopsis lyrata870854346169483472483473483470
485842483469903754483471485118
318457318019887375912061470596
Arabidopsis thalianaAT2G43570.1AT2G43610.1AT2G43620.1AT2G43590.1AT3G54420.1
AT2G43580.1AT1G56680.1AT3G47540.1AT3G47540.2AT2G43600.1
AT3G16920.1AT3G12500.1AT1G02360.1AT4G01700.1AT1G05850.1
Brachypodium distachyonBradi3g48230.1Bradi5g14430.1Bradi2g11140.1Bradi1g29887.1Bradi2g47210.1
Bradi1g29880.1Bradi2g47190.1Bradi2g26000.1Bradi3g32340.1Bradi2g36780.1
Bradi3g40320.1
Brassica rapaBra000311Bra022797Bra000310Bra037698Bra000314
Bra023009Bra007071Bra004773Bra004771Bra004772
Bra000315Bra037699Bra005345Bra027940Bra000312
Bra039597Bra034754Bra038726Bra001453Bra036316
Bra001454Bra033318Bra038727Bra015457Bra030628
Carica papayaevm.model.supercontig_9.348evm.model.supercontig_50.122evm.model.supercontig_57.23evm.TU.contig_34724.1evm.model.supercontig_183.6
Capsella rubellaCarubv10023810mCarubv10023814mCarubv10025331mCarubv10025277mCarubv10023855m
Carubv10017824mCarubv10023795mCarubv10023857mCarubv10009026mCarubv10023874m
Carubv10025330mCarubv10018014mCarubv10014131mCarubv10014185mCarubv10010007m
Carubv10020662mCarubv10002987mCarubv10009762m
Citrus clementinaCiclev10022063mCiclev10022050mCiclev10023297mCiclev10021602mCiclev10022123m
Ciclev10002362mCiclev10005421mCiclev10026057mCiclev10021721mCiclev10028959m
Ciclev10028964mCiclev10028831mCiclev10021187mCiclev10003750mCiclev10023611m
Citrus sinensisorange1.1g026928morange1.1g023873morange1.1g032687morange1.1g032636morange1.1g020187m
orange1.1g024628morange1.1g026315morange1.1g043794morange1.1g025237morange1.1g029634m
orange1.1g036277morange1.1g030642morange1.1g033376morange1.1g045378m
Cucumis sativusCucsa.044140.1Cucsa.152090.1Cucsa.252640.2Cucsa.252640.1Cucsa.044130.1
Cucsa.044190.1Cucsa.374230.1Cucsa.044170.1Cucsa.322970.1Cucsa.044160.1
Cucsa.094420.1
Eucalyptus grandisEucgr.H00323.1Eucgr.H00327.1Eucgr.H00329.1Eucgr.A00020.1Eucgr.H00320.1
Eucgr.H00328.1Eucgr.H00324.1Eucgr.H00321.1Eucgr.H00326.1Eucgr.H00325.1
Eucgr.K02166.2Eucgr.K02166.1Eucgr.A00021.1Eucgr.H00322.1.154.247Eucgr.H00322.1.154.247
Eucgr.H04034.1Eucgr.L00941.1.97.206Eucgr.L00941.1.97.206Eucgr.L00939.1.135.205Eucgr.L00939.1.135.205
Eucgr.I01495.1Eucgr.I02271.1Eucgr.J02518.1Eucgr.J02519.1Eucgr.L00937.1
Eucgr.L00938.1Eucgr.A00999.1Eucgr.H00455.2Eucgr.H00455.1Eucgr.I02267.1
Eucgr.I02246.1Eucgr.I02242.1Eucgr.H00322.1.79.146Eucgr.H00322.1.79.146Eucgr.L00941.1.27.93
Eucgr.L00941.1.27.93Eucgr.I02240.1Eucgr.I01953.1Eucgr.I02269.1
Fragaria vescamrna21704.1-v1.0-hybridmrna02717.1-v1.0-hybridmrna21702.1-v1.0-hybridmrna21697.1-v1.0-hybridmrna13071.1-v1.0-hybrid
mrna22465.1-v1.0-hybridmrna05162.1-v1.0-hybridmrna13072.1-v1.0-hybrid.384.618mrna13072.1-v1.0-hybrid.384.618mrna13072.1-v1.0-hybrid.384.618
mrna24481.1-v1.0-hybridmrna17204.1-v1.0-hybridmrna29267.1-v1.0-hybridmrna13072.1-v1.0-hybrid.191.299mrna13072.1-v1.0-hybrid.191.299
mrna13072.1-v1.0-hybrid.191.299mrna13072.1-v1.0-hybrid.74.133mrna13072.1-v1.0-hybrid.74.133mrna13072.1-v1.0-hybrid.74.133
Glycine maxGlyma11g13270.2Glyma13g42210.1Glyma12g05310.1Glyma01g36480.1Glyma09g04330.1
Glyma15g15360.1Glyma10g27870.2.165.239Glyma10g27870.2.165.239Glyma02g04820.1Glyma16g22680.1
Glyma19g40960.1Glyma02g01020.1Glyma02g04820.3Glyma02g04820.2Glyma08g29090.1
Glyma18g51980.1Glyma10g27870.2.29.163Glyma10g27870.2.29.163Glyma12g05301.1
Gossypium raimondiiGorai.006G230700.1Gorai.011G137200.1Gorai.006G230300.1Gorai.006G230600.1Gorai.006G230400.1
Gorai.011G137500.1Gorai.006G230600.2Gorai.011G137300.1Gorai.002G203600.1Gorai.002G203500.1
Gorai.007G117600.1Gorai.010G058900.1Gorai.005G258100.1Gorai.005G258000.1Gorai.005G257900.1
Gorai.005G257900.2Gorai.011G198500.1Gorai.011G005100.1Gorai.006G078900.1
Linum usitatissimumLus10003587Lus10032794Lus10010861Lus10024368Lus10010862
Lus10035621.215.414Lus10035621.215.414Lus10003226Lus10024367Lus10035624
Lus10003231Lus10003227Lus10035625Lus10024369Lus10024366
Lus10010866Lus10010864Lus10003230Lus10035618Lus10000453
Lus10035620.203.389Lus10035620.203.389Lus10028377Lus10041830Lus10010863
Lus10035620.29.206Lus10035620.29.206Lus10041831Lus10000193Lus10016872
Lus10009968Lus10038026Lus10041278Lus10037430Lus10037737
Lus10037428Lus10041282Lus10035621.80.147Lus10035621.80.147Lus10000217
Lus10028378Lus10041829
Malus domesticaMDP0000702868MDP0000193383MDP0000873235MDP0000535247MDP0000430546
MDP0000139609MDP0000712620MDP0000527355MDP0000218549MDP0000424978
MDP0000701077MDP0000418201MDP0000128190.164.225MDP0000128190.164.225MDP0000118748
MDP0000710349MDP0000224397MDP0000417095MDP0000142174MDP0000945042
MDP0000236701MDP0000132926MDP0000701985MDP0000207220MDP0000128190.44.162
MDP0000128190.44.162MDP0000421802MDP0000655939MDP0000258512
Manihot esculentacassava4.1_013738mcassava4.1_021052mcassava4.1_034087mcassava4.1_033496mcassava4.1_030454m
cassava4.1_014554mcassava4.1_027629mcassava4.1_012136mcassava4.1_012170mcassava4.1_011409m
cassava4.1_032694mcassava4.1_011797mcassava4.1_013633mcassava4.1_011942mcassava4.1_023221m
cassava4.1_024852m
Medicago truncatulaMedtr2g099470.1.351.553Medtr2g099470.1.351.553Medtr2g099470.1.80.281Medtr2g099470.1.80.281Medtr2g034680.1
Medtr3g118390.1Medtr8g074330.1.80.313Medtr8g074330.1.80.313Medtr8g074350.1Medtr7g110780.1
Medtr8g074330.1.403.622Medtr8g074330.1.403.622Medtr7g021640.1
Mimulus guttatusmgv1a023931mmgv1a011768mmgv1a011672mmgv1a011702mmgv1a010106m
mgv1a010097mmgv1a010054mmgv1a010053mmgv1a010049m
Oryza sativaLOC_Os04g41620.1LOC_Os04g41680.1LOC_Os02g39330.1LOC_Os03g04060.1LOC_Os06g51060.1
LOC_Os01g18400.1LOC_Os06g51050.1LOC_Os05g33130.1LOC_Os05g33140.1LOC_Os03g30470.1
LOC_Os05g04690.1LOC_Os10g39680.1LOC_Os05g33150.1LOC_Os08g41100.1LOC_Os09g32080.2
LOC_Os09g32080.1LOC_Os10g39700.1
Panicum virgatumPavirv00001344mPavirv00013542mPavirv00060537mPavirv00042800mPavirv00034056m
Pavirv00032638mPavirv00050897mPavirv00070140mPavirv00057986mPavirv00011518m
Pavirv00032107mPavirv00050898mPavirv00067187mPavirv00010783mPavirv00065101m
Pavirv00060702mPavirv00012807mPavirv00030437mPavirv00052078mPavirv00025489m
Pavirv00018303mPavirv00012836mPavirv00027304mPavirv00066381mPavirv00057487m
Pavirv00001806mPavirv00061195mPavirv00052213mPavirv00054024mPavirv00070706m
Pavirv00069180mPavirv00027778mPavirv00070141m
Physcomitrella patensPp1s184_140V6.1Pp1s15_171V6.1Pp1s197_8V6.1Pp1s134_173V6.1Pp1s178_23V6.1
Pp1s309_77V6.1Pp1s287_72V6.1Pp1s197_7V6.1Pp1s55_35V6.1Pp1s305_13V6.1
Pp1s306_17V6.1Pp1s133_32V6.1
Phaseolus vulgarisPhvul.005G155800.1Phvul.011G051500.1Phvul.002G114100.1Phvul.009G254400.1Phvul.009G116600.1
Phvul.009G116300.1Phvul.002G114200.1Phvul.009G116700.1Phvul.001G218600.1Phvul.003G268600.1
Phvul.003G268500.1Phvul.007G208900.1Phvul.009G116500.1Phvul.008G018100.1
Picea abiesMA_191308g0010MA_295712g0010MA_159244g0020MA_10427514g0010MA_36141g0010
MA_10435326g0010MA_448160g0010MA_10431378g0010MA_114934g0010MA_10262473g0010
MA_741127g0010MA_10431378g0020MA_44734g0010MA_10430424g0010MA_10294851g0010
MA_7544918g0010MA_853077g0010MA_10099693g0010.98.197MA_10099693g0010.98.197MA_170598g0010
MA_10431347g0010MA_656046g0010MA_595151g0010MA_9376357g0010MA_19732g0010
MA_5029466g0010MA_60284g0010MA_224992g0010MA_10435764g0010MA_4984466g0010
MA_8921185g0010MA_123187g0010MA_18470g0010MA_10313114g0010MA_80085g0010
MA_18470g0020MA_10425967g0010MA_6639198g0010MA_3814373g0010MA_726207g0010.58.202
MA_726207g0010.58.202MA_726207g0010.206.325MA_726207g0010.206.325MA_177881g0010MA_9682123g0010
MA_4343642g0010MA_5970350g0010MA_10099693g0010.27.98MA_10099693g0010.27.98MA_102538g0010
MA_3682012g0010MA_9952704g0010MA_490809g0010MA_134123g0010
Populus trichocarpaPotri.013G125100.1Potri.019G093800.1Potri.019G093900.1Potri.019G094100.1Potri.019G094000.1
Potri.013G125000.1Potri.019G093700.1Potri.009G142200.2Potri.010G141600.3Potri.010G141600.2
Potri.009G141700.1Potri.004G182000.1Potri.002G186500.1Potri.T175200.1Potri.014G111800.1
Potri.009G142300.1Potri.009G141800.1Potri.009G142200.1Potri.009G142000.2Potri.009G142000.1
Potri.T175300.2Potri.T175300.1Potri.009G142100.1Potri.004G182100.1Potri.004G182100.4
Potri.004G182100.3Potri.004G182100.5Potri.010G141600.1Potri.014G146600.4Potri.014G146600.3
Potri.014G146600.1Potri.014G146600.2Potri.004G182100.6Potri.004G182100.7Potri.004G182100.2
Prunus persicappa024941mppa010952mppa010947mppa010731mppa009844m
ppa009653mppa009661mppa018821mppa008743mppa025091m
ppa008646mppa008859mppa017347mppa008643m
Ricinus communis27753.m00001629830.m00141829641.m00037629889.m00326830098.m001726
29797.m00035630076.m00454729797.m00035427852.m000039
Setaria italicaSi020916mSi010816mSi010827mSi010980mSi010838m
Si010776mSi011679mSi010959mSi018061mSi037098m
Si024048m.143.263Si024048m.143.263Si002491mSi008781mSi037175m
Si024596mSi014136mSi039658mSi030486mSi024048m.65.133
Si024048m.65.133
Selaginella moellendorffii1270214312431343144306
430442974332429836340
4267101382177582138199426722
13820314583614768446851443112
227948
Sorghum bicolorSb06g021240.1Sb06g021230.1Sb06g021250.1Sb06g021210.1Sb06g021220.1
Sb06g021260.1Sb03g013610.1Sb04g025430.1Sb01g048140.1Sb07g027310.1
Sb09g001210.1Sb06g016510.1Sb09g003040.1Sb03g011710.1Sb3219s002010.1
Sb09g019660.1Sb02g028770.1
Thellungiella halophilaThhalv10001590mThhalv10001575mThhalv10010625mThhalv10001581mThhalv10001579m
Thhalv10017716mThhalv10001580mThhalv10001788mThhalv10014413mThhalv10021094m
Thhalv10021149mThhalv10028870mThhalv10008465mThhalv10008219mThhalv10008215m
Thhalv10001652m
Vitis viniferaGSVIVT01038125001GSVIVT01038117001GSVIVT01038111001GSVIVT01038116001GSVIVT01038126001
GSVIVT01038114001.324.523GSVIVT01038114001.324.523GSVIVT01028243001GSVIVT01038113001GSVIVT01038108001
GSVIVT01038120001GSVIVT01031685001GSVIVT01035029001GSVIVT01007190001GSVIVT01038114001.16.134
GSVIVT01038114001.16.134
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)