y PlantCAZyme

CAZyme Information

Basic Information
SpeciesBrachypodium distachyon
Cazyme IDBradi4g34950.1
FamilyGH1
Protein PropertiesLength: 506 Molecular Weight: 57549.8 Isoelectric Point: 7.0258
ChromosomeChromosome/Scaffold: 4 Start: 40504134 End: 40507779
Descriptionbeta glucosidase 11
View CDS
External Links
NCBI Taxonomy
Plaza
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GH1264880
  RHDFPDGFIFGAGTSAYQVEGAAAEDGRKPSIWDTFTHQGYSYDKSTADISADQYHHYKDDVKLMHEIGLDAYRFSIAWPRLIPDGRGRINPKGLKYYNN
  LIDELIRHDIQPHVTIYHLDFPQSLQDEYKGLLSPRFVDDYTAYADACFKSFGDRVKHWVTVNEPNIETIGSFDSGELPPRRCSYPFGVNCTGGNSTTEP
  YIAAHRLLLAHASAVSLYRDKYQGTQRGQIGITLLGWWHEPATKASRDAAAATRMNDFHIGWFMHPLVYGDYPPVMRRRVGARLPYLTAEQSKNLSGSFD
  FVGFNHYLVVRAQSDERAFDRKQRDYYNDAAAIANPFKDIQEGHLESAPWALGKLLDHLRLKYRNPPVMIHENGFADAPKTPSKIEFDDDYRSEYLQDYL
  EVLYQSIRNGSDARGYFVWSFLDVFELLFGYASRFGLCGVDMNAVERTRYMRNSARWYSSFLK
Full Sequence
Protein Sequence     Length: 506     Download
MAMLLYFLLL LLRLTALPRD SAALTRHDFP DGFIFGAGTS AYQVEGAAAE DGRKPSIWDT    60
FTHQGYSYDK STADISADQY HHYKDDVKLM HEIGLDAYRF SIAWPRLIPD GRGRINPKGL    120
KYYNNLIDEL IRHDIQPHVT IYHLDFPQSL QDEYKGLLSP RFVDDYTAYA DACFKSFGDR    180
VKHWVTVNEP NIETIGSFDS GELPPRRCSY PFGVNCTGGN STTEPYIAAH RLLLAHASAV    240
SLYRDKYQGT QRGQIGITLL GWWHEPATKA SRDAAAATRM NDFHIGWFMH PLVYGDYPPV    300
MRRRVGARLP YLTAEQSKNL SGSFDFVGFN HYLVVRAQSD ERAFDRKQRD YYNDAAAIAN    360
PFKDIQEGHL ESAPWALGKL LDHLRLKYRN PPVMIHENGF ADAPKTPSKI EFDDDYRSEY    420
LQDYLEVLYQ SIRNGSDARG YFVWSFLDVF ELLFGYASRF GLCGVDMNAV ERTRYMRNSA    480
RWYSSFLKGG ELRPGSPSGK GYGVA*                                         540
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
TIGR03356BGL7.0e-11330483462+
pfam00232Glyco_hydro_12.0e-13729489465+
PLN02814PLN028142.0e-15320489474+
PLN02998PLN029984.0e-15821498479+
PLN02849PLN028496.0e-16119496479+
Gene Ontology
GO TermDescription
GO:0004553hydrolase activity, hydrolyzing O-glycosyl compounds
GO:0005975carbohydrate metabolic process
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankEEC84871.102349429510hypothetical protein OsI_32014 [Oryza sativa Indica Group]
GenBankEEC84872.102549732498hypothetical protein OsI_32015 [Oryza sativa Indica Group]
RefSeqNP_001063640.101949430500Os09g0511900 [Oryza sativa (japonica cultivar-group)]
Swiss-ProtQ0J0G101949426496BGL33_ORYSJ RecName: Full=Probable inactive beta-glucosidase 33; Short=Os9bglu33; Flags: Precursor
Swiss-ProtQ0J0G202549732504BGL32_ORYSJ RecName: Full=Beta-glucosidase 32; Short=Os9bglu32; Flags: Precursor
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB3gnr_A0144882487B Chain B, Crystal Structure Of The Complex Between Pectin Methylesterase And Its Inhibitor Protein
PDB3gnp_A0144882487B Chain B, Crystal Structure Of The Complex Between Pectin Methylesterase And Its Inhibitor Protein
PDB3gno_A0144882487A Chain A, Crystal Structure Of A Rice Os3bglu6 Beta-glucosidase
PDB2rgm_B0184889480A Chain A, Crystal Structure Of A Rice Os3bglu6 Beta-glucosidase
PDB2rgm_A0184889480A Chain A, Crystal Structure Of A Rice Os3bglu6 Beta-glucosidase
Metabolic Pathways
Pathway NameReactionECProtein Name
coumarin biosynthesis (via 2-coumarate)RXN-8036EC-3.2.1.21β-glucosidase
linamarin degradationRXN-5341EC-3.2.1.21β-glucosidase
linustatin bioactivationRXN-13602EC-3.2.1.21β-glucosidase
linustatin bioactivationRXN-5341EC-3.2.1.21β-glucosidase
lotaustralin degradationRXN-9674EC-3.2.1.21β-glucosidase
neolinustatin bioactivationRXN-13603EC-3.2.1.21β-glucosidase
neolinustatin bioactivationRXN-9674EC-3.2.1.21β-glucosidase
taxiphyllin bioactivationRXN-13600EC-3.2.1.21β-glucosidase
Signal Peptide
Cleavage Site
23
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
GT792467248192660
GO855768313243350
GO867562282213010
HX172278232182490
CJ705161277563320
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_003_00732.1Aquca_015_00033.2Aquca_015_00033.1Aquca_003_00738.1Aquca_003_00734.1
Aquca_018_00002.1Aquca_003_00738.2Aquca_003_00736.1Aquca_003_00738.4Aquca_003_00738.3
Aquca_003_00738.5Aquca_003_00733.2Aquca_003_00733.1Aquca_003_00735.1Aquca_003_00735.2
Aquca_003_00731.1Aquca_003_00734.3Aquca_003_00730.1Aquca_003_00734.2Aquca_003_00735.3
Aquca_003_00733.3Aquca_029_00030.1Aquca_003_00732.2Aquca_015_00029.1Aquca_029_00032.2
Aquca_015_00035.1Aquca_003_00738.7Aquca_015_00034.1Aquca_029_00032.1Aquca_003_00738.6
Aquca_003_00733.4Aquca_003_00734.5Aquca_003_00734.4Aquca_007_00054.1Aquca_003_00738.8
Aquca_003_00738.9Aquca_003_00738.11Aquca_003_00738.10Aquca_035_00146.2Aquca_035_00146.1
Aquca_015_00035.3Aquca_003_00738.12Aquca_015_00033.3Aquca_015_00035.4Aquca_015_00034.2
Aquca_015_00035.2Aquca_003_00738.13Aquca_007_00054.2Aquca_003_00738.15Aquca_003_00738.14
Aquca_003_00733.5Aquca_035_00146.3Aquca_015_00030.1Aquca_003_00735.4
Arabidopsis lyrata491999314159486775878433907850
326101315311486774492664315321
875932
Arabidopsis thalianaAT1G02850.2AT1G02850.5AT4G27830.1AT1G02850.4AT1G02850.3
AT1G02850.1AT4G22100.1AT4G27820.1AT1G45191.2AT1G45191.1
AT1G60090.1AT3G62750.1AT3G62740.1AT1G60260.1AT1G60270.1
AT5G16580.1
Brachypodium distachyonBradi2g59650.1Bradi2g27770.1Bradi3g45627.1Bradi2g59660.1Bradi3g45650.1
Bradi3g45640.1Bradi4g34927.1Bradi4g34940.1Bradi4g34940.3Bradi2g09200.1
Bradi3g45607.1Bradi4g34940.4Bradi2g09187.1Bradi4g34940.2
Brassica rapaBra033352Bra007699Bra000461.210.665Bra007698Bra034697
Bra014395Bra006755Bra015094Bra021441Bra006756
Bra013234Bra030064Bra015096
Carica papayaevm.TU.contig_25278.3evm.model.supercontig_9.230
Capsella rubellaCarubv10004624mCarubv10007006mCarubv10013516mCarubv10008974mCarubv10011227m
Carubv10017050mCarubv10018691mCarubv10017328m
Citrus clementinaCiclev10019719mCiclev10019788mCiclev10029910mCiclev10028386mCiclev10020433m
Ciclev10020639mCiclev10020770m
Citrus sinensisorange1.1g012181morange1.1g015605morange1.1g015785morange1.1g046009morange1.1g018009m
orange1.1g017505morange1.1g024821morange1.1g020989morange1.1g013298m.26.240orange1.1g013298m.26.240
Cucumis sativusCucsa.097180.1Cucsa.336940.1Cucsa.336950.1
Eucalyptus grandisEucgr.J00646.1Eucgr.J00645.2Eucgr.J00645.1Eucgr.K03473.1Eucgr.J00648.1
Eucgr.J00645.3Eucgr.J00647.1
Fragaria vescamrna03448.1-v1.0-hybridmrna03449.1-v1.0-hybrid
Glycine maxGlyma02g02230.3Glyma14g39230.1Glyma16g19480.1Glyma07g18410.1Glyma07g18400.1
Glyma02g02230.4Glyma02g17490.2Glyma14g39230.2Glyma02g02230.2
Gossypium raimondiiGorai.009G076100.2Gorai.009G076100.1
Linum usitatissimumLus10007871Lus10007872
Malus domesticaMDP0000212560MDP0000135510MDP0000938307
Manihot esculentacassava4.1_032290mcassava4.1_005780mcassava4.1_006332mcassava4.1_022817m
Medicago truncatulaMedtr5g068740.1Medtr1g088610.1Medtr4g016920.1Medtr1g088630.2Medtr1g088630.1
Medtr1g088630.3Medtr1g088630.4Medtr1g088630.5Medtr1g088630.6
Mimulus guttatusmgv1a007433m
Oryza sativaLOC_Os09g33680.1LOC_Os05g30350.1LOC_Os05g30280.3LOC_Os05g30250.1LOC_Os01g59819.1
LOC_Os01g59840.1LOC_Os01g70520.1LOC_Os09g33690.2LOC_Os05g30350.2LOC_Os05g30300.1
LOC_Os09g33710.1LOC_Os05g30280.1LOC_Os09g33680.2LOC_Os01g70520.2LOC_Os09g33690.1
LOC_Os05g30390.1LOC_Os09g33690.4LOC_Os05g30250.2LOC_Os09g33690.3
Panicum virgatumPavirv00030236mPavirv00034053mPavirv00007719mPavirv00011930mPavirv00060992m
Pavirv00043199mPavirv00052823mPavirv00060993mPavirv00000833mPavirv00012938m
Pavirv00034054mPavirv00034055mPavirv00000834mPavirv00004602mPavirv00000835m
Phaseolus vulgarisPhvul.007G145900.1Phvul.008G097600.1Phvul.008G097700.1Phvul.008G097200.1Phvul.008G097000.1
Phvul.008G097100.1Phvul.008G097100.3Phvul.008G097100.2Phvul.008G097300.1
Picea abiesMA_10434198g0010.219.693MA_10434198g0010.219.693MA_139193g0010MA_10436515g0030MA_12813g0010
Prunus persicappa004484mppa006167mppa019582mppa015330m
Ricinus communis29986.m00160629986.m00160129986.m00160329986.m00160229986.m001604
Setaria italicaSi021753mSi021785mSi001092mSi013564mSi032721m
Si013822mSi029509mSi001840mSi002332m
Sorghum bicolorSb02g029640.4Sb02g029640.3Sb02g029640.2Sb03g037780.1Sb09g018160.1
Sb09g018180.2Sb09g018180.1Sb02g029640.1Sb10g022300.1Sb02g029620.1
Thellungiella halophilaThhalv10005908mThhalv10024994mThhalv10004056mThhalv10002493mThhalv10028552m
Thhalv10002501mThhalv10006510mThhalv10004297mThhalv10003058mThhalv10006515m
Vitis viniferaGSVIVT01028006001.499.961GSVIVT01028006001.499.961GSVIVT01028004001.196.654GSVIVT01028004001.196.654GSVIVT01028004001.196.654
GSVIVT01028006001.29.484GSVIVT01028006001.29.484GSVIVT01028001001
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)