y PlantCAZyme

CAZyme Information

Basic Information
SpeciesBrachypodium distachyon
Cazyme IDBradi4g38200.1
FamilyGT50
Protein PropertiesLength: 446 Molecular Weight: 50840.3 Isoelectric Point: 10.0198
ChromosomeChromosome/Scaffold: 4 Start: 43200887 End: 43203957
Descriptionmannosyltransferase family protein
View CDS
External Links
NCBI Taxonomy
Plaza
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GT501324210
  IGTRGNCEPVVCAAILWILLCLMKGRVLQAAFWYGLIVHFRIYPIIYAIPFVIVLSKNYAGPAGRPILTQLSSKQKLQSNKANENVEEPKSLLATLWTSL
  SSLITKDTILFGLLSGSMFFAWTGVFFYLYGWEFLNEALLYHLTRTDPRHNFSIYFYHIYLHHQRGFSSIQKLASFLPQLIVQLALILRFSRDLPFCLFL
  QTVAFVAFNKVMTAQYFVWFFCLVPLVLPWTSMKLKWKGLSCILVWMGSQLHWLMWAYLLEFKGQNVFVQLWVAGLVFLAANTFVMIMVI
Full Sequence
Protein Sequence     Length: 446     Download
MASAAASTTF RWLMVASAAL RLALVAYGEW QDAHLEVRYT DVDYLVFSDA AASVAAGWSP    60
FARATYRYSP LLAFLLLPNS LLHPAWGKLL FSAADLLVGL FIDNILTLRG IPEKTRIWSV    120
AAWLFNPFTF TIGTRGNCEP VVCAAILWIL LCLMKGRVLQ AAFWYGLIVH FRIYPIIYAI    180
PFVIVLSKNY AGPAGRPILT QLSSKQKLQS NKANENVEEP KSLLATLWTS LSSLITKDTI    240
LFGLLSGSMF FAWTGVFFYL YGWEFLNEAL LYHLTRTDPR HNFSIYFYHI YLHHQRGFSS    300
IQKLASFLPQ LIVQLALILR FSRDLPFCLF LQTVAFVAFN KVMTAQYFVW FFCLVPLVLP    360
WTSMKLKWKG LSCILVWMGS QLHWLMWAYL LEFKGQNVFV QLWVAGLVFL AANTFVMIMV    420
IKHHKYTPLF LAPVKSRSKI TTKKE*                                         480
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
pfam06728PIG-U6.0e-589202125+
pfam05007Mannosyl_trans5.0e-71132421292+
PLN02841PLN0284103445443+
Gene Ontology
GO TermDescription
GO:0005789endoplasmic reticulum membrane
GO:0006506GPI anchor biosynthetic process
GO:0016021integral to membrane
GO:0016758transferase activity, transferring hexosyl groups
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankACG32572.1054454443PNT1 [Zea mays]
GenBankEEC75897.102844526444hypothetical protein OsI_12951 [Oryza sativa Indica Group]
RefSeqNP_001050869.102844526444Os03g0670200 [Oryza sativa (japonica cultivar-group)]
RefSeqNP_001132411.1054454443hypothetical protein LOC100193858 [Zea mays]
RefSeqXP_002461964.1014451443hypothetical protein SORBIDRAFT_02g011300 [Sorghum bicolor]
Transmembrane Domains
StartEnd
163185
240262
347364
374391
398420
Signal Peptide
Cleavage Site
28
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
GT0343612931574460
JG9444102671804460
JG8826892691784460
FL9564412581784350
CB6665902112374460
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_040_00057.1Aquca_027_00011.1Aquca_035_00139.1Aquca_027_00005.1Aquca_083_00090.1
Aquca_027_00008.1Aquca_083_00081.1Aquca_008_00278.1
Arabidopsis lyrata910198
Arabidopsis thalianaAT5G22130.2AT5G22130.1
Brassica rapaBra020174
Carica papayaevm.model.supercontig_9.382.128.333evm.model.supercontig_9.382.128.333evm.model.supercontig_9.382.364.444evm.model.supercontig_9.382.364.444
Capsella rubellaCarubv10000947m
Chlamydomonas reinhardtiiCre14.g616200.t1.2.125.281Cre14.g616200.t1.2.125.281Cre14.g616200.t1.2.354.469Cre14.g616200.t1.2.354.469
Citrus clementinaCiclev10001079m
Citrus sinensisorange1.1g012470morange1.1g020664morange1.1g014361m.155.293orange1.1g014361m.292.401orange1.1g014361m.292.401
orange1.1g014361m.155.293orange1.1g020629m
Cucumis sativusCucsa.099160.1
Eucalyptus grandisEucgr.H00040.1
Fragaria vescamrna23760.1-v1.0-hybrid
Glycine maxGlyma08g16980.1
Gossypium raimondiiGorai.001G088100.1
Linum usitatissimumLus10000321Lus10013349
Malus domesticaMDP0000259191MDP0000246795MDP0000134018
Manihot esculentacassava4.1_033019m
Medicago truncatulaMedtr8g040610.1
Mimulus guttatusmgv1a006636mmgv1a019000mmgv1a018848m
Oryza sativaLOC_Os03g46750.1
Panicum virgatumPavirv00041326mPavirv00060844m
Physcomitrella patensPp1s171_137V6.1
Phaseolus vulgarisPhvul.005G043300.1
Picea abiesMA_10434160g0010
Populus trichocarpaPotri.001G031500.1Potri.001G031500.2
Prunus persicappa005934m
Ricinus communis30040.m000266
Setaria italicaSi029845m
Selaginella moellendorffii90874
Sorghum bicolorSb02g011300.1
Thellungiella halophilaThhalv10015361mThhalv10013575m
Vitis viniferaGSVIVT01017167001
Volvox carteriVocar20014433m
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny