y PlantCAZyme

CAZyme Information

Basic Information
SpeciesBrachypodium distachyon
Cazyme IDBradi4g39410.1
FamilyCE10
Protein PropertiesLength: 354 Molecular Weight: 38513.4 Isoelectric Point: 8.2157
ChromosomeChromosome/Scaffold: 4 Start: 44000856 End: 44006568
Descriptionalpha/beta-Hydrolases superfamily protein
View CDS
External Links
NCBI Taxonomy
Plaza
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
CE101173432.4e-34
  KRYPAAFEDGVTVLRWIAKQANLAACGRMMAKGAGTCGTDSFGAAMVEPWLAAHADPSRCVLLGVSCGANIADYVARKAVEAGKFLDPVKVVAQVLMYPF
  FMGSSPTQSELKLANSYFYDKSTCLLAWKLFLPEDEFCLDHPAANPLLPGRGPPLKLMPPTLTIVAELDWMKDRAIAYSEELRKVNVDAPVLEYKDAVHE
  FATLDGLLKTPEAQACAEDIAIWVKKY
Full Sequence
Protein Sequence     Length: 354     Download
MPSVTVKLYS LIFKLLLRRR LSSLSVSDPA PAGAASSFGV SSRPADHHPS PHSNPAFSTA    60
APDAVATKDL HPDPLSSLHL RLFLPNPHHA TPLNNPPPPP LRRSSFPERG CKGNWQKRYP    120
AAFEDGVTVL RWIAKQANLA ACGRMMAKGA GTCGTDSFGA AMVEPWLAAH ADPSRCVLLG    180
VSCGANIADY VARKAVEAGK FLDPVKVVAQ VLMYPFFMGS SPTQSELKLA NSYFYDKSTC    240
LLAWKLFLPE DEFCLDHPAA NPLLPGRGPP LKLMPPTLTI VAELDWMKDR AIAYSEELRK    300
VNVDAPVLEY KDAVHEFATL DGLLKTPEAQ ACAEDIAIWV KKYISLRGHE FSY*          360
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
COG0657Aes6.0e-10118337221+
pfam07859Abhydrolase_31.0e-29118318201+
Gene Ontology
GO TermDescription
GO:0008152metabolic process
GO:0016787hydrolase activity
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankEEE53026.14e-1711081110hypothetical protein OsJ_35742 [Oryza sativa Japonica Group]
GenBankEEE53026.10116353185472hypothetical protein OsJ_35742 [Oryza sativa Japonica Group]
RefSeqNP_001066506.16e-1711081110Os12g0256000 [Oryza sativa (japonica cultivar-group)]
RefSeqNP_001066506.10116353204441Os12g0256000 [Oryza sativa (japonica cultivar-group)]
RefSeqXP_002311735.1013531387predicted protein [Populus trichocarpa]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB3ed1_F7e-20116320158330A Chain A, Bromoperoxidase A2 Mutant M99t
PDB3ed1_E7e-20116320158330A Chain A, Bromoperoxidase A2 Mutant M99t
PDB3ed1_D7e-20116320158330A Chain A, Bromoperoxidase A2 Mutant M99t
PDB3ed1_C7e-20116320158330A Chain A, Bromoperoxidase A2 Mutant M99t
PDB3ed1_B7e-20116320158330A Chain A, Bromoperoxidase A2 Mutant M99t
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
ES7899762531163540
JK5155042501163540
DR9372002491163540
EB4388452511163540
EX1307062531163540
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_011_00310.1Aquca_123_00012.1
Arabidopsis lyrata484517488268
Arabidopsis thalianaAT5G14310.1AT3G27320.2AT3G27320.1
Brachypodium distachyonBradi2g57920.1
Brassica rapaBra006247Bra032997Bra008767
Carica papayaevm.model.supercontig_130.43evm.model.supercontig_130.44
Capsella rubellaCarubv10017202mCarubv10000956m
Citrus clementinaCiclev10031742mCiclev10015160m
Citrus sinensisorange1.1g015994morange1.1g012432m
Cucumis sativusCucsa.156360.1
Eucalyptus grandisEucgr.B03228.1Eucgr.I01696.1
Fragaria vescamrna28030.1-v1.0-hybrid
Glycine maxGlyma19g24390.1Glyma16g06780.1Glyma05g06430.1Glyma19g22760.1
Gossypium raimondiiGorai.006G038400.1Gorai.007G074300.2Gorai.012G091000.1Gorai.002G190500.1Gorai.001G268100.1
Gorai.011G093200.1Gorai.007G074300.1
Linum usitatissimumLus10037056Lus10036931Lus10022326
Malus domesticaMDP0000464809MDP0000303241MDP0000479020MDP0000251187
Manihot esculentacassava4.1_006786mcassava4.1_009359m
Mimulus guttatusmgv1a026769mmgv1a021886mmgv1a005804m
Oryza sativaLOC_Os12g15400.1LOC_Os01g67600.1
Panicum virgatumPavirv00029958mPavirv00024043mPavirv00043387m
Physcomitrella patensPp1s540_9V6.1
Phaseolus vulgarisPhvul.004G057500.1Phvul.008G149400.1
Picea abiesMA_19054g0010MA_10435834g0010
Populus trichocarpaPotri.008G180500.1Potri.008G180600.1Potri.T111700.1Potri.010G053700.1
Prunus persicappa025969mppa005102m
Ricinus communis29633.m00088529929.m004742
Selaginella moellendorffii123940
Sorghum bicolorSb03g042970.1
Thellungiella halophilaThhalv10013549m
Vitis viniferaGSVIVT01003964001GSVIVT01010303001
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny