y PlantCAZyme

CAZyme Information

Basic Information
SpeciesBrachypodium distachyon
Cazyme IDBradi4g41410.1
FamilyGT1
Protein PropertiesLength: 480 Molecular Weight: 51116 Isoelectric Point: 4.9592
ChromosomeChromosome/Scaffold: 4 Start: 45504608 End: 45506211
DescriptionUDP-Glycosyltransferase superfamily protein
View CDS
External Links
NCBI Taxonomy
Plaza
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GT12744561e-35
  GSCISWLDTQAPGSVLYASLGSVIPVQKDEFAEVAWGLAGSGVPFLWVVRRGLVAGGGESDPDLPDGFERAVEGRGKVVRWAPQREALAHGAVGGFWTHS
  GWNSTLESVHEGVPMLCRPLFGDQPVNARYVGEAWKNGVLLMEGEKKLERGKIAQAIRAFMDPGEKGDEMRERAEELRRQSAA
Full Sequence
Protein Sequence     Length: 480     Download
MAVVVDDDGL TRGGGRRRIV LFPLPFQGHI SPMLQLADVL HRRGHLAVTV LHTARNAPDP    60
AARPDGFDFV PVPDGMPAAV AASDDPLEKI LAMNAAMDTS GCVRDALASI LLSATEEQQP    120
VSCLIMDTAL PAAQKAAAAL GLPTVVLHTV SAASTRLYRS YAMLHDKGYL PAQEQELNRP    180
VKELPPLRVS DLFDPSKHPD QESANKILDG NFRTTSNSAG VVINTFEALE TPELAALRAE    240
LGSTGTSTKV FAIGPLHELS AIDAAASSLQ EQDGSCISWL DTQAPGSVLY ASLGSVIPVQ    300
KDEFAEVAWG LAGSGVPFLW VVRRGLVAGG GESDPDLPDG FERAVEGRGK VVRWAPQREA    360
LAHGAVGGFW THSGWNSTLE SVHEGVPMLC RPLFGDQPVN ARYVGEAWKN GVLLMEGEKK    420
LERGKIAQAI RAFMDPGEKG DEMRERAEEL RRQSAACLEP GGGSTCRAVD ELVDHILSL*    480
                                                                     540
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
PLN02562PLN025623.0e-4921456450+
PLN02863PLN028632.0e-4921479482+
PLN02555PLN025559.0e-5521476473+
PLN02448PLN024481.0e-6323476467+
PLN02410PLN024107.0e-8921479462+
Gene Ontology
GO TermDescription
GO:0008152metabolic process
GO:0016758transferase activity, transferring hexosyl groups
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankACG28221.101847914469cytokinin-N-glucosyltransferase 1 [Zea mays]
DDBJBAC16077.10124797463putative UDP-glucosyltransferase [Oryza sativa Japonica Group]
DDBJBAF21183.20124797464Os07g0241700 [Oryza sativa Japonica Group]
GenBankEAZ03341.10124797464hypothetical protein OsI_25482 [Oryza sativa Indica Group]
RefSeqXP_002459587.101847920475hypothetical protein SORBIDRAFT_02g007110 [Sorghum bicolor]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB2pq6_A0164648466A Chain A, Crystal Structure Of Medicago Truncatula Ugt85h2- Insights Into The Structural Basis Of A Multifunctional (Iso) Flavonoid Glycosyltransferase
PDB2vg8_A5.04467e-44184658457A Chain A, Crystal Structure Of Medicago Truncatula Ugt85h2- Insights Into The Structural Basis Of A Multifunctional (Iso) Flavonoid Glycosyltransferase
PDB2vch_A5.04467e-44184658457A Chain A, Crystal Structure Of Medicago Truncatula Ugt85h2- Insights Into The Structural Basis Of A Multifunctional (Iso) Flavonoid Glycosyltransferase
PDB2vce_A5.04467e-44184658457A Chain A, Characterization And Engineering Of The Bifunctional N- And O-glucosyltransferase Involved In Xenobiotic Metabolism In Plants
PDB2c9z_A8e-397247669450A Chain A, Characterization And Engineering Of The Bifunctional N- And O-glucosyltransferase Involved In Xenobiotic Metabolism In Plants
Metabolic Pathways
Pathway NameReactionECProtein Name
DIBOA-glucoside biosynthesisRXN-7021EC-2.4.1.2022,4-dihydroxy-7-methoxy-2H-1,4-benzoxazin-3(4H)-one 2 -D-glucosyltransferase
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
DV4888851992474450
EG631253460214800
CA1025342391433800
EE0385752821744510
HX1775422102714800
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_005_00046.1Aquca_009_00820.1Aquca_009_00819.1Aquca_009_00818.1Aquca_023_00029.1
Aquca_011_00581.1Aquca_011_00592.1Aquca_011_00582.1Aquca_011_00591.1
Arabidopsis lyrata325212916575487386486004872501
867000486005487387496094485042
886188347758485040487389485039
481506494174905874865981865978
865974494179
Arabidopsis thalianaAT5G05870.1AT3G46650.1AT3G46660.1AT5G38010.1AT5G05860.1
AT3G55700.1AT3G55710.1AT5G05880.1AT3G11340.1AT5G05890.1
AT5G59580.1AT3G46670.1AT5G05900.1AT5G59590.1AT3G46680.1
AT3G46700.1AT3G46690.1AT5G38040.1AT3G46720.1AT2G26480.1
Brachypodium distachyonBradi1g53520.1Bradi1g27275.1Bradi4g39370.1Bradi1g27290.1Bradi1g27270.1
Bradi4g12360.1Bradi1g27290.2Bradi1g53560.1Bradi1g53540.1Bradi1g53527.1
Bradi1g53550.1Bradi2g19780.1Bradi3g15945.1
Brassica rapaBra009143Bra007184Bra002556Bra034848Bra009144
Bra003220Bra009142Bra005869Bra009145Bra009146
Bra033808Bra009147Bra018203Bra020310Bra031102
Bra018201Bra018202Bra000542Bra006707Bra033807
Carica papayaevm.model.supercontig_19.246evm.model.supercontig_81.42evm.model.supercontig_81.31evm.model.supercontig_81.38evm.model.supercontig_81.29
evm.model.supercontig_19.242evm.model.supercontig_19.243evm.model.supercontig_19.244evm.model.supercontig_19.245evm.model.supercontig_81.40
evm.model.supercontig_81.32evm.model.supercontig_81.46evm.TU.contig_40501.1
Capsella rubellaCarubv10025043mCarubv10019445mCarubv10017158mCarubv10019480mCarubv10017212m
Carubv10013696mCarubv10000929mCarubv10000926mCarubv10018552mCarubv10026384m
Carubv10027963mCarubv10017233mCarubv10017284mCarubv10017253mCarubv10017240m
Carubv10018900mCarubv10019422mCarubv10018747mCarubv10017421m
Citrus clementinaCiclev10031408mCiclev10031368mCiclev10031404mCiclev10013877mCiclev10030404m
Ciclev10011602mCiclev10028405mCiclev10030812m.58.219Ciclev10030812m.58.219Ciclev10030803m.58.219
Ciclev10030803m.58.219Ciclev10001065mCiclev10004935mCiclev10030812m.508.702Ciclev10030812m.508.702
Ciclev10030803m.513.707Ciclev10030803m.513.707Ciclev10028392mCiclev10020064mCiclev10030245m
Ciclev10028300mCiclev10028422mCiclev10028419mCiclev10027296mCiclev10028437m
Ciclev10028217mCiclev10003724m
Citrus sinensisorange1.1g011832morange1.1g048753morange1.1g012587morange1.1g011848morange1.1g037374m
orange1.1g037999morange1.1g011792morange1.1g044936morange1.1g011531morange1.1g024869m
orange1.1g013342morange1.1g012735morange1.1g040486morange1.1g012678morange1.1g012474m
orange1.1g012543morange1.1g012563morange1.1g012151morange1.1g012613morange1.1g020179m
orange1.1g018483morange1.1g014232morange1.1g046167morange1.1g013836morange1.1g016062m
Cucumis sativusCucsa.164750.1Cucsa.164740.1Cucsa.164800.1Cucsa.164720.1Cucsa.066730.1
Cucsa.146680.1Cucsa.136380.1Cucsa.068420.1Cucsa.146660.1Cucsa.146670.1
Eucalyptus grandisEucgr.B02292.1Eucgr.G03009.1Eucgr.G03014.1Eucgr.A00424.1Eucgr.G03013.1
Eucgr.G03010.1Eucgr.J00979.1Eucgr.J00976.1Eucgr.J00977.1Eucgr.B02744.1
Eucgr.L02290.1Eucgr.J00970.1Eucgr.G03006.1Eucgr.J01973.1Eucgr.G03007.1
Eucgr.J01968.1Eucgr.J00972.1Eucgr.B02291.1Eucgr.J01967.1Eucgr.J01971.1
Eucgr.J01963.1Eucgr.J01962.1Eucgr.J00971.1
Fragaria vescamrna18747.1-v1.0-hybridmrna34103.1-v1.0-hybridmrna34102.1-v1.0-hybrid
Glycine maxGlyma01g02670.1Glyma01g02740.2Glyma03g16250.1Glyma03g16310.1Glyma03g16296.1
Glyma11g34720.1Glyma11g34730.1Glyma11g14260.2Glyma12g06221.1
Gossypium raimondiiGorai.001G113300.1Gorai.011G275800.1Gorai.011G274800.1Gorai.011G275600.1Gorai.011G275700.1
Gorai.011G275300.1Gorai.011G275300.2Gorai.011G275100.3Gorai.011G275100.2Gorai.011G275100.1
Gorai.011G275400.4Gorai.011G275400.2Gorai.011G275400.1Gorai.011G275400.3Gorai.011G275000.1
Gorai.012G074100.1Gorai.011G275200.1Gorai.012G109200.4Gorai.012G109200.3Gorai.012G109200.2
Gorai.012G109200.1Gorai.011G274700.1Gorai.012G073900.1Gorai.009G321100.1Gorai.001G113200.1
Gorai.001G113900.1Gorai.001G113800.1Gorai.001G114000.1
Linum usitatissimumLus10016459Lus10004670Lus10017201Lus10014831Lus10009876
Lus10037268Lus10040246Lus10004671Lus10004672Lus10040725
Lus10016460Lus10016461Lus10004673Lus10035681
Malus domesticaMDP0000234251MDP0000168272MDP0000771573MDP0000096923MDP0000293001
MDP0000673553MDP0000651396MDP0000390437MDP0000630319MDP0000288886
MDP0000299496MDP0000375039MDP0000791553MDP0000705244MDP0000292949
MDP0000523619MDP0000601017MDP0000202898MDP0000196394MDP0000240663
MDP0000304625MDP0000551467MDP0000255642MDP0000708060MDP0000123636
MDP0000172043MDP0000591257MDP0000671121
Manihot esculentacassava4.1_007674mcassava4.1_006281mcassava4.1_006726mcassava4.1_021325mcassava4.1_007065m
cassava4.1_029835mcassava4.1_031775mcassava4.1_028931mcassava4.1_027442mcassava4.1_026577m
Medicago truncatulaMedtr5g031840.1Medtr5g031830.1Medtr5g031860.1Medtr3g069690.1Medtr3g069710.1
Medtr6g014160.1
Mimulus guttatusmgv1a023633mmgv1a005050mmgv1a005720mmgv1a005336m
Oryza sativaLOC_Os07g30610.1LOC_Os07g14630.1LOC_Os11g25454.1LOC_Os07g13770.1LOC_Os07g30760.1
LOC_Os07g30469.1LOC_Os07g30369.1LOC_Os07g30620.1LOC_Os07g30690.1LOC_Os07g30330.1
LOC_Os09g03140.1LOC_Os07g13800.1LOC_Os07g13634.1LOC_Os03g60960.1LOC_Os07g13660.1
LOC_Os07g13810.1LOC_Os07g42970.1
Panicum virgatumPavirv00034964mPavirv00070665mPavirv00005440mPavirv00018266mPavirv00016972m
Pavirv00015728mPavirv00026421mPavirv00026178mPavirv00024746mPavirv00068805m
Pavirv00040191mPavirv00009136mPavirv00042788mPavirv00010936mPavirv00059965m
Pavirv00020520mPavirv00041610mPavirv00064634mPavirv00065860mPavirv00056851m
Pavirv00007059mPavirv00021384mPavirv00048201mPavirv00001378mPavirv00051012m
Pavirv00066800mPavirv00048212mPavirv00025068mPavirv00058575mPavirv00032551m
Pavirv00000131m
Phaseolus vulgarisPhvul.002G145900.1Phvul.002G146200.1Phvul.002G146100.1Phvul.010G001300.1Phvul.010G009000.1
Phvul.011G060300.1Phvul.001G238800.1Phvul.001G238900.1
Populus trichocarpaPotri.008G062400.2Potri.008G062400.1Potri.016G105400.1Potri.016G105300.1Potri.010G195600.1
Potri.010G195300.1Potri.010G195500.1Potri.009G039000.2Potri.009G039000.1Potri.001G245900.1
Potri.006G039300.1
Prunus persicappa025605mppa005447mppa016769mppa019804mppa022102m
ppa025141mppa005539mppa016206mppa005623mppa005624m
ppa017124mppa018563mppa020483mppa019614mppa020431m
ppa016568m
Ricinus communis29610.m00038929610.m00039029751.m00183029751.m00182829790.m000840
Setaria italicaSi013725mSi013705mSi032617mSi029738mSi032476m
Si029654mSi024741mSi029672mSi029739mSi029735m
Si029711mSi033228mSi029813mSi029803mSi035560m
Si032090mSi029717mSi035584mSi035523mSi035261m
Si029630mSi033128mSi032122mSi015361mSi017426m
Sorghum bicolorSb09g028320.2Sb09g028320.1Sb02g007090.1Sb02g007100.1Sb02g007140.1
Sb02g033580.1Sb02g033570.1Sb02g007110.1Sb02g007080.1Sb01g002890.1
Sb01g002870.1Sb01g002860.1Sb02g007150.1Sb10g028810.1Sb02g007260.1
Thellungiella halophilaThhalv10010354mThhalv10013505mThhalv10002769mThhalv10003055mThhalv10020723m
Thhalv10011136mThhalv10013513mThhalv10013500mThhalv10013508mThhalv10007597m
Thhalv10002845mThhalv10015913mThhalv10002978mThhalv10003098mThhalv10002974m
Vitis viniferaGSVIVT01016422001GSVIVT01033638001
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)