y PlantCAZyme

CAZyme Information

Basic Information
SpeciesBrachypodium distachyon
Cazyme IDBradi4g42490.1
FamilyGT29
Protein PropertiesLength: 408 Molecular Weight: 43392 Isoelectric Point: 10.134
ChromosomeChromosome/Scaffold: 4 Start: 46456073 End: 46457653
DescriptionGlycosyltransferase family 29 (sialyltransferase) family protein
View CDS
External Links
NCBI Taxonomy
Plaza
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GT291663840
  RTTKAPTCAVVGNSGVLLGSGRGAQIDAHGLVIRLNNARIAGFGPDVGGRTSLSFANSNILHLCASHAAATAPGCGCHPYGAAVPMAMYVCQPAHLLDAL
  ICNATAGANPFRLILTDPRLDALAARIAKYYSLRRFVTSSSSSAAAAAGGWAKKHDERYFHYSSGLQAVVMALGLCEEVSLFGFGKPPGAKHHYHTNQKK
  ELDLHDYEAEYEFYGDLQD
Full Sequence
Protein Sequence     Length: 408     Download
MKRRHLPPAL ALVLLSLLSL SLRRRTPLQP PPPPPPPIHA AKPAAGDPLL RRLAAAESAG    60
YSQLLADAAA LFANGSISTF PSLGGRYRLL YLRLPQTPGG PPRPRTISRA RVPAGALPSD    120
DSLLAAFRAS LRSFLLSHRR LRRAGAGNVA AVMTDLPFTS ALLGPRTTKA PTCAVVGNSG    180
VLLGSGRGAQ IDAHGLVIRL NNARIAGFGP DVGGRTSLSF ANSNILHLCA SHAAATAPGC    240
GCHPYGAAVP MAMYVCQPAH LLDALICNAT AGANPFRLIL TDPRLDALAA RIAKYYSLRR    300
FVTSSSSSAA AAAGGWAKKH DERYFHYSSG LQAVVMALGL CEEVSLFGFG KPPGAKHHYH    360
TNQKKELDLH DYEAEYEFYG DLQDRPETVP FLDEAHGFTV PPVRLYW*                 420
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
pfam00777Glyco_transf_294.0e-717222756+
pfam00777Glyco_transf_293.0e-932838261+
Gene Ontology
GO TermDescription
GO:0006486protein glycosylation
GO:0008373sialyltransferase activity
GO:0030173integral to Golgi membrane
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankACN30607.10714071340unknown [Zea mays]
GenBankEAY82275.1014061395hypothetical protein OsI_37484 [Oryza sativa Indica Group]
RefSeqNP_001066170.1014071396Os12g0151500 [Oryza sativa (japonica cultivar-group)]
RefSeqNP_001150867.1014071402sialyltransferase-like protein [Zea mays]
RefSeqXP_002449004.1014071400hypothetical protein SORBIDRAFT_05g003160 [Sorghum bicolor]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB2wnf_A0.000000000000716236389262A Chain A, E. Coli Gsp Amidase Cys59 Sulfenic Acid
PDB2wnb_A0.000000000000716236389262A Chain A, Crystal Structure Of A Mammalian Sialyltransferase In Complex With Disaccharide And Cmp
PDB2wml_A0.000000000000716236389262A Chain A, Crystal Structure Of A Mammalian Sialyltransferase
Signal Peptide
Cleavage Site
23
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
FF3543532141964080
CK2112162201904080
BQ7530871882224080
CK0533612041723740
FF3543541802304080
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_004_00099.1
Arabidopsis lyrata470889
Arabidopsis thalianaAT1G08280.1
Brachypodium distachyonBradi5g15097.1Bradi2g55530.1
Brassica rapaBra018639
Carica papayaevm.model.supercontig_32.97
Capsella rubellaCarubv10009362m
Citrus clementinaCiclev10028611m
Citrus sinensisorange1.1g045324m
Cucumis sativusCucsa.385070.1
Eucalyptus grandisEucgr.B03871.2Eucgr.B03871.1Eucgr.B03872.1
Fragaria vescamrna22044.1-v1.0-hybrid
Glycine maxGlyma12g09360.1Glyma12g09380.1Glyma12g09370.1Glyma11g19080.1
Gossypium raimondiiGorai.004G009500.1Gorai.009G086400.1Gorai.001G121600.1Gorai.001G121600.2
Linum usitatissimumLus10043382Lus10019538
Malus domesticaMDP0000819808MDP0000297352MDP0000232578
Manihot esculentacassava4.1_025383mcassava4.1_029496m
Medicago truncatulaMedtr4g053520.1
Mimulus guttatusmgv1a007914m
Oryza sativaLOC_Os01g63970.1LOC_Os04g42760.1LOC_Os12g05550.1
Panicum virgatumPavirv00000013mPavirv00026461mPavirv00017508mPavirv00017918mPavirv00063645m
Pavirv00039153mPavirv00003354mPavirv00055978m
Physcomitrella patensPp1s66_22V6.1Pp1s258_38V6.1Pp1s269_58V6.1
Phaseolus vulgarisPhvul.011G093000.1
Picea abiesMA_473578g0010MA_5257g0010MA_76451g0010MA_10437278g0030MA_10426176g0010
MA_180941g0010
Populus trichocarpaPotri.009G144000.1Potri.004G184200.1
Prunus persicappa006961m
Ricinus communis30055.m001540
Setaria italicaSi010021mSi001764mSi028299mSi012629mSi027686m
Selaginella moellendorffii133452589
Sorghum bicolorSb05g003170.1Sb05g003150.1Sb06g021930.1Sb05g003160.1Sb03g040480.1
Thellungiella halophilaThhalv10007826m
Vitis viniferaGSVIVT01036150001
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny