y PlantCAZyme

CAZyme Information

Basic Information
SpeciesBrachypodium distachyon
Cazyme IDBradi4g44070.1
FamilyGT8
Protein PropertiesLength: 633 Molecular Weight: 72551.9 Isoelectric Point: 8.7421
ChromosomeChromosome/Scaffold: 4 Start: 47601385 End: 47606017
Descriptiongalacturonosyltransferase 7
View CDS
External Links
NCBI Taxonomy
Plaza
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GT83016050
  CLNMRLTLEFFKSTSIQKDQLSTQRLEDPAFHHYVMFTRNVLAASTTINSTVMNSKDSGSVVFHLFTDVQNFYAMKHWFDRNSYLEAIVHVSNIEDHQKL
  SKGVESIEMQQLWPTEEFRVTFRNHSQPFQRQMKTEYISVFGHSHFFLPDLLPSLNRVVVLDDDVIVQKDLSSLWKLNMGDKVIGAVQFCGVRLGQLKAY
  TEEHNFDTDSCVWFSGLNVIELEKWRDLGVASLHDQFLQKLQKDSLVSHRLKALPRGLLAFQDLIYPLKDSWVQSGLGYDYGITRSDIEKAATVHYNGVM
  KPWLD
Full Sequence
Protein Sequence     Length: 633     Download
MKGHHLASAP AAKRRCSGMA AAVPALVLCS VLLPLAFLLG LHRTGYGSEE RAAVVISTEL    60
GIGKHKHLDG GGLTKHKLLK DVSKNEISGK KPSRSKSRNL SAKSKSKLKG ELQNDTTKSR    120
GPHTQRRYQL KDLSLRSMDT TVGVEENQGQ EVANEENPKS CELEYGSYCL WSVEHKEVMK    180
DAIVKRLKDQ LFMARAHYPS IAKLKHQERF TRELKQNIQE HERMLSDTIS DADLPRFFAK    240
KLEKMEHTIE RAKSCEVGCS NVERKLRQLL DITEDEAYFH TRQSAFLYHL GAQTMPKTHH    300
CLNMRLTLEF FKSTSIQKDQ LSTQRLEDPA FHHYVMFTRN VLAASTTINS TVMNSKDSGS    360
VVFHLFTDVQ NFYAMKHWFD RNSYLEAIVH VSNIEDHQKL SKGVESIEMQ QLWPTEEFRV    420
TFRNHSQPFQ RQMKTEYISV FGHSHFFLPD LLPSLNRVVV LDDDVIVQKD LSSLWKLNMG    480
DKVIGAVQFC GVRLGQLKAY TEEHNFDTDS CVWFSGLNVI ELEKWRDLGV ASLHDQFLQK    540
LQKDSLVSHR LKALPRGLLA FQDLIYPLKD SWVQSGLGYD YGITRSDIEK AATVHYNGVM    600
KPWLDLGIHE YESYWRKYMT NGERFMTECN IH*                                 660
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
cd06429GT8_like_16.0e-102332620289+
PLN02718PLN027186.0e-102177632465+
PLN02910PLN029101.0e-104125631523+
PLN02829PLN028295.0e-116178631463+
PLN02769PLN0276901632638+
Gene Ontology
GO TermDescription
GO:0016757transferase activity, transferring glycosyl groups
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankABA95691.20606321596Glycosyl transferase family 8 protein, expressed [Oryza sativa (japonica cultivar-group)]
GenBankEEC67573.1016321642hypothetical protein OsI_34919 [Oryza sativa Indica Group]
GenBankEEC68769.101363217659hypothetical protein OsI_37298 [Oryza sativa Indica Group]
RefSeqNP_001065619.1016321642Os11g0124900 [Oryza sativa (japonica cultivar-group)]
RefSeqXP_002441763.1016321654hypothetical protein SORBIDRAFT_08g002010 [Sorghum bicolor]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB1ga8_A0.000943360374252A Chain A, Crystal Structure Of A Rice Os3bglu6 Beta-glucosidase
PDB1g9r_A0.000943360374252A Chain A, Crystal Structure Of Galactosyltransferase Lgtc In Complex With Mn And Udp-2f-Galactose
PDB1ss9_A0.00443352674165A Chain A, Crystal Structural Analysis Of Active Site Mutant Q189e Of Lgtc
PDB3tzt_B0.0144762796276A Chain A, The Structure Of A Protein In Glycosyl Transferase Family 8 From Anaerococcus Prevotii.
PDB3tzt_A0.0144762796276A Chain A, The Structure Of A Protein In Glycosyl Transferase Family 8 From Anaerococcus Prevotii.
Metabolic Pathways
Pathway NameReactionECProtein Name
homogalacturonan biosynthesis2.4.1.43-RXNEC-2.4.1.43polygalacturonate 4-α-galacturonosyltransferase
Transmembrane Domains
StartEnd
2042
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
GO854789336483770
JG9624412641394020
DV5036632653626260
FG5527521934416330
FG5527521522914420
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_004_00589.1Aquca_004_00589.4Aquca_004_00589.2Aquca_004_00589.3Aquca_004_00589.5
Aquca_004_00589.6Aquca_004_00589.7Aquca_004_00589.8Aquca_004_00589.9
Arabidopsis lyrata482874
Arabidopsis thalianaAT2G38650.1AT2G38650.2
Brachypodium distachyonBradi1g63520.1Bradi1g17570.1Bradi3g61120.1
Brassica rapaBra017110Bra005091Bra000081
Carica papayaevm.model.supercontig_63.51
Capsella rubellaCarubv10022827mCarubv10022960m
Citrus clementinaCiclev10011265mCiclev10011297m
Citrus sinensisorange1.1g006506morange1.1g006959morange1.1g010099m
Cucumis sativusCucsa.002900.3Cucsa.002900.1Cucsa.002900.4
Eucalyptus grandisEucgr.A00881.2Eucgr.A00881.1
Fragaria vescamrna13645.1-v1.0-hybrid
Glycine maxGlyma16g09405.1Glyma18g45226.1Glyma09g40610.2
Gossypium raimondiiGorai.005G129100.4Gorai.005G129100.5Gorai.005G129100.2Gorai.006G236100.1Gorai.006G236100.2
Gorai.006G236100.3Gorai.006G236100.4Gorai.005G129100.1Gorai.005G129100.3
Linum usitatissimumLus10003235Lus10035615
Malus domesticaMDP0000922484MDP0000174912
Manihot esculentacassava4.1_005865mcassava4.1_034453m
Medicago truncatulaMedtr7g074680.1
Mimulus guttatusmgv1a002878m
Oryza sativaLOC_Os11g03160.1LOC_Os03g21250.1LOC_Os07g48370.1LOC_Os05g40720.1LOC_Os12g02910.1
Panicum virgatumPavirv00000593mPavirv00014347mPavirv00006239mPavirv00024569mPavirv00069223m
Pavirv00024467mPavirv00048424mPavirv00040432mPavirv00034218mPavirv00014348m
Phaseolus vulgarisPhvul.008G076900.1
Picea abiesMA_118216g0010
Populus trichocarpaPotri.T138200.1Potri.016G144000.1Potri.016G144000.2Potri.006G114300.1Potri.006G114300.2
Potri.006G114300.3Potri.006G114300.4
Prunus persicappa002860m
Ricinus communis30073.m002205
Setaria italicaSi009553mSi029187mSi026080mSi021466mSi034649m
Sorghum bicolorSb09g023760.1Sb01g036430.1Sb02g043170.1Sb08g002010.1
Thellungiella halophilaThhalv10016387mThhalv10016389m
Vitis viniferaGSVIVT01029827001
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)