y PlantCAZyme

CAZyme Information

Basic Information
SpeciesBrachypodium distachyon
Cazyme IDBradi4g44510.1
FamilyAA2
Protein PropertiesLength: 287 Molecular Weight: 30487.3 Isoelectric Point: 8.2047
ChromosomeChromosome/Scaffold: 4 Start: 47878583 End: 47885534
DescriptionPeroxidase superfamily protein
View CDS
External Links
NCBI Taxonomy
Plaza
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
AA2352661.4e-33
  IGKETRIGASILQLFFHDCFVQGCDGSLLLDDTAGKMWYTLAGSRRSFLPKKNGGRIALIRVPVCTSYAAMCVVAAGPSWEVKLGRRDSTTASFAGANAN
  MPAATSGLRELTDLFANQGLSQKDMVALSGSHTLGQARCVNFDIDSGFAGTHRSSCSSNSVSGDGNSLAPLDLQTPLVFENNYYKNLVDRKGLLHSDQEL
  FNGGVTDQQVRSYVDNQSVFFADFLAGMIKLG
Full Sequence
Protein Sequence     Length: 287     Download
MAAGSWAQQQ LSTGFYSASC PGAQAAVRSA VESAIGKETR IGASILQLFF HDCFVQGCDG    60
SLLLDDTAGK MWYTLAGSRR SFLPKKNGGR IALIRVPVCT SYAAMCVVAA GPSWEVKLGR    120
RDSTTASFAG ANANMPAATS GLRELTDLFA NQGLSQKDMV ALSGSHTLGQ ARCVNFDIDS    180
GFAGTHRSSC SSNSVSGDGN SLAPLDLQTP LVFENNYYKN LVDRKGLLHS DQELFNGGVT    240
DQQVRSYVDN QSVFFADFLA GMIKLGDISP LTGTNGQIRK NCRRIN*                  300
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
cd00691ascorbate_peroxidase7.0e-19108265172+
cd00314plant_peroxidase_like9.0e-2126266277+
PLN03030PLN030309.0e-331286320+
pfam00141peroxidase2.0e-4027250241+
cd00693secretory_peroxidase2.0e-9910285309+
Gene Ontology
GO TermDescription
GO:0004601peroxidase activity
GO:0006979response to oxidative stress
GO:0020037heme binding
GO:0055114oxidation-reduction process
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankACN33662.101028623320unknown [Zea mays]
RefSeqNP_001131000.101028623320hypothetical protein LOC100192105 [Zea mays]
RefSeqXP_002450132.101028636331hypothetical protein SORBIDRAFT_05g001000 [Sorghum bicolor]
RefSeqXP_002450133.101028633328hypothetical protein SORBIDRAFT_05g001010 [Sorghum bicolor]
RefSeqXP_002489046.10228619320hypothetical protein SORBIDRAFT_0246s002010 [Sorghum bicolor]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB1sch_B0102861294A Chain A, Peanut Peroxidase
PDB1sch_A0102861294A Chain A, Peanut Peroxidase
PDB1qo4_A0102862304A Chain A, Peanut Peroxidase
PDB1pa2_A0102862304A Chain A, Arabidopsis Thaliana Peroxidase A2
PDB3atj_B0102862306A Chain A, Heme Ligand Mutant Of Recombinant Horseradish Peroxidase In Complex With Benzhydroxamic Acid
Metabolic Pathways
Pathway NameReactionECProtein Name
betanidin degradationRXN-8635EC-1.11.1.7peroxidase
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
DN551857298102870
CK263268302102840
CN13702728312620
HX140612270342770
JG577989287102700
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_003_00142.1Aquca_029_00102.1
Brachypodium distachyonBradi5g00690.1
Citrus sinensisorange1.1g022375morange1.1g025013m
Fragaria vescamrna28146.1-v1.0-hybridmrna21306.1-v1.0-hybrid
Linum usitatissimumLus10030145.156.325Lus10030145.156.325
Medicago truncatulaMedtr3g072210.1
Oryza sativaLOC_Os03g22010.3LOC_Os12g02080.2
Panicum virgatumPavirv00064327mPavirv00026915mPavirv00051402mPavirv00019628m
Picea abiesMA_414832g0010MA_10433993g0010MA_19749g0010MA_10430578g0010MA_91956g0010
MA_746078g0010MA_74610g0010
Populus trichocarpaPotri.013G156500.1.166.334Potri.013G156500.1.166.334
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny