y PlantCAZyme

CAZyme Information

Basic Information
SpeciesBrachypodium distachyon
Cazyme IDBradi5g01230.1
FamilyGT1
Protein PropertiesLength: 615 Molecular Weight: 66503 Isoelectric Point: 6.0455
ChromosomeChromosome/Scaffold: 5 Start: 1143385 End: 1152298
DescriptionUDP-Glycosyltransferase superfamily protein
View CDS
External Links
NCBI Taxonomy
Plaza
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GT11755830
  VGTRGDVQPFVAIGKRLQDYGHRVRLATHANYKEFILTAGLEFFPLGGDPKILAEYMVKNKGFLPSGPSEIPIQRKQMKEIIFSLYPACKDPDPDTGVPF
  NVDAIIANPPAYGHTHVAEALKVPIHIFFTMPWTPTSEFPHPLSRVKQSAGYRLSYQIVDSMIWLGIRDMINEFRKKKLKLRPVTYLSGAQGSGNDIPHG
  YIWSPHLVPKPKDWGPKIDVVGFCFLDLASDYVPPEELVKWLESGDKPIYIGFGSLPVQDPAKMTETIVQALEMTGQRGIINKGWGGLGTLAEPKDFVYV
  LDNCPHDWLFLQCKAVVHHGGAGTTAAGLKAACPTTIVPFFGDQPFWGDRVHARGVGPPPIPVDLFSLQKLVDAIKFMLEPEVKERAVELAKAMESEDGV
  TGAVRAFLK
Full Sequence
Protein Sequence     Length: 615     Download
MAAAEGSGKG LEGGGGSEAS EAPNGDLSAD NSDPTTAAAA APMASSSSSA DNGNLHRSST    60
MPGVIKDAEI TNETLAPSNL ERSRTERRRQ NNPADDPAKQ LLDDKISIRK KLKMLNRIAT    120
VKDDGTVVVD VPSTLEATPV DAGAEDGYCD VAVDESLDGA DIPYRPPMQI VILIVGTRGD    180
VQPFVAIGKR LQDYGHRVRL ATHANYKEFI LTAGLEFFPL GGDPKILAEY MVKNKGFLPS    240
GPSEIPIQRK QMKEIIFSLY PACKDPDPDT GVPFNVDAII ANPPAYGHTH VAEALKVPIH    300
IFFTMPWTPT SEFPHPLSRV KQSAGYRLSY QIVDSMIWLG IRDMINEFRK KKLKLRPVTY    360
LSGAQGSGND IPHGYIWSPH LVPKPKDWGP KIDVVGFCFL DLASDYVPPE ELVKWLESGD    420
KPIYIGFGSL PVQDPAKMTE TIVQALEMTG QRGIINKGWG GLGTLAEPKD FVYVLDNCPH    480
DWLFLQCKAV VHHGGAGTTA AGLKAACPTT IVPFFGDQPF WGDRVHARGV GPPPIPVDLF    540
SLQKLVDAIK FMLEPEVKER AVELAKAMES EDGVTGAVRA FLKHLPSRTE QNSPRPPSGF    600
LEFLGPVGKC LGCS*                                                     660
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
COG1819COG18191.0e-30167589436+
pfam03033Glyco_transf_287.0e-36170314145+
cd03784GT1_Gtf_like9.0e-121168584421+
Gene Ontology
GO TermDescription
GO:0005975carbohydrate metabolic process
GO:0008152metabolic process
GO:0016758transferase activity, transferring hexosyl groups
GO:0030259lipid glycosylation
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
EMBLCAB06081.1016141608UDP-glucose:sterol glucosyltransferase [Avena sativa]
GenBankEEC76698.105161446609hypothetical protein OsI_14701 [Oryza sativa Indica Group]
GenBankEEE60430.105160746602hypothetical protein OsJ_13635 [Oryza sativa Japonica Group]
RefSeqNP_001052094.105161446609Os04g0131900 [Oryza sativa (japonica cultivar-group)]
RefSeqNP_001151796.101955621546LOC100285431 [Zea mays]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB3h4t_A7e-331685941389A Chain A, Structure Of Ugt78g1 Complexed With Myricetin And Udp
PDB3h4i_A7e-331685941389A Chain A, Chimeric Glycosyltransferase For The Generation Of Novel Natural Products
PDB1rrv_B2e-251685731387A Chain A, X-Ray Crystal Structure Of Tdp-Vancosaminyltransferase Gtfd As A Complex With Tdp And The Natural Substrate, Desvancosaminyl Vancomycin.
PDB1rrv_A2e-251685731387A Chain A, X-Ray Crystal Structure Of Tdp-Vancosaminyltransferase Gtfd As A Complex With Tdp And The Natural Substrate, Desvancosaminyl Vancomycin.
PDB1pnv_B5e-211685821384A Chain A, X-Ray Crystal Structure Of Tdp-Vancosaminyltransferase Gtfd As A Complex With Tdp And The Natural Substrate, Desvancosaminyl Vancomycin.
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
GO8831663321324630
GT0463523351775110
GT0483653183006150
JG8777202811804600
GT046352325045350.0003
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_034_00218.3Aquca_034_00218.2Aquca_034_00218.1Aquca_023_00154.1Aquca_034_00218.4
Aquca_023_00154.3Aquca_023_00154.2Aquca_114_00011.1Aquca_114_00011.2
Arabidopsis lyrata896855473768910517
Arabidopsis thalianaAT3G07020.2AT3G07020.1AT1G43620.3AT1G43620.2AT1G43620.1
AT5G24750.1
Brachypodium distachyonBradi2g56102.1Bradi3g07997.4Bradi3g07997.3Bradi3g07997.2
Brassica rapaBra001229Bra040355Bra029615Bra020468
Carica papayaevm.model.supercontig_8.181evm.model.supercontig_21.209
Capsella rubellaCarubv10013188mCarubv10013187mCarubv10008593mCarubv10002561m
Chlamydomonas reinhardtiiCre07.g333450.t1.2
Citrus clementinaCiclev10020154mCiclev10011454mCiclev10000559mCiclev10000975m
Citrus sinensisorange1.1g013358morange1.1g006412morange1.1g008369morange1.1g013835morange1.1g047047m
Cucumis sativusCucsa.078450.1Cucsa.140330.2Cucsa.140330.1Cucsa.356970.2Cucsa.078450.2
Cucsa.363720.1
Eucalyptus grandisEucgr.H00810.1Eucgr.B01378.1Eucgr.F02699.1Eucgr.H01372.1Eucgr.B01630.1
Eucgr.F02699.2Eucgr.H01372.2Eucgr.G00612.3Eucgr.G00612.1Eucgr.G00612.2
Fragaria vescamrna16762.1-v1.0-hybridmrna17551.1-v1.0-hybridmrna08139.1-v1.0-hybrid
Glycine maxGlyma03g19751.1Glyma18g28130.2Glyma18g28130.1Glyma18g47490.2Glyma18g47490.1
Glyma02g08940.1Glyma10g36850.2Glyma20g30760.2Glyma20g30760.4Glyma20g30760.3
Glyma09g38830.2Glyma20g30760.6Glyma20g30760.5Glyma02g08940.2Glyma08g19700.2
Gossypium raimondiiGorai.001G184700.2Gorai.001G184700.10Gorai.001G184700.1Gorai.004G058300.2Gorai.004G058300.1
Gorai.004G261100.2Gorai.004G261100.1Gorai.009G254800.4Gorai.009G254800.3Gorai.009G254800.2
Gorai.009G254800.1Gorai.001G184700.3Gorai.009G254800.5Gorai.001G184700.4Gorai.001G184700.5
Gorai.001G184700.7Gorai.001G184700.6Gorai.001G184700.8Gorai.004G261100.3Gorai.008G041600.1
Linum usitatissimumLus10020382Lus10011882Lus10024544Lus10022815Lus10018878
Lus10009556Lus10028572Lus10011883Lus10020381Lus10009557
Malus domesticaMDP0000304346MDP0000278182MDP0000175609MDP0000304996MDP0000152076
MDP0000243097MDP0000771934MDP0000895000
Manihot esculentacassava4.1_004218mcassava4.1_003877mcassava4.1_025328mcassava4.1_014281m
Medicago truncatulaMedtr4g022580.1Medtr7g079430.1Medtr1g098640.2Medtr1g098640.1Medtr1g098640.3
Medtr4g022610.1
Mimulus guttatusmgv1a002910mmgv1a003019mmgv1a022288mmgv1a023756mmgv1a010079m
mgv1a004761mmgv1a005156m
Oryza sativaLOC_Os07g23740.3LOC_Os07g23740.2LOC_Os07g23740.1LOC_Os04g04254.2LOC_Os04g04254.1
LOC_Os01g64750.1LOC_Os04g04240.1LOC_Os02g11940.1
Panicum virgatumPavirv00030954mPavirv00043473mPavirv00043474mPavirv00048943mPavirv00056277m
Pavirv00034065mPavirv00051133m
Physcomitrella patensPp1s90_132V6.1Pp1s245_59V6.1Pp1s110_116V6.1Pp1s159_62V6.1Pp1s281_20V6.1
Pp1s131_65V6.1
Phaseolus vulgarisPhvul.008G056500.2Phvul.008G056500.1Phvul.010G013800.1Phvul.007G080800.1Phvul.004G093900.3
Phvul.004G093900.2Phvul.004G093900.1Phvul.006G212700.1
Picea abiesMA_84359g0010
Populus trichocarpaPotri.014G178300.1Potri.002G067100.1Potri.002G238600.4Potri.002G238600.2Potri.002G238600.1
Potri.002G067100.2Potri.005G193100.1Potri.002G238600.3Potri.003G021100.2Potri.003G021100.1
Prunus persicappa019814mppa002976mppa002535mppa005311m
Ricinus communis30204.m00179130128.m00900929863.m00104933210.m00003430116.m000381
Setaria italicaSi029583mSi009641mSi009639mSi017298m
Selaginella moellendorffii11051343056026840374515406232
Sorghum bicolorSb06g001270.1Sb03g040980.1Sb06g001270.2Sb02g010030.1Sb04g007366.1
Thellungiella halophilaThhalv10020288mThhalv10005442mThhalv10004004m
Vitis viniferaGSVIVT01028556001GSVIVT01034544001GSVIVT01019162001GSVIVT01023003001
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)