y PlantCAZyme

CAZyme Information

Basic Information
SpeciesBrachypodium distachyon
Cazyme IDBradi5g01970.1
FamilyCE6
Protein PropertiesLength: 301 Molecular Weight: 31871.8 Isoelectric Point: 7.1452
ChromosomeChromosome/Scaffold: 5 Start: 2048838 End: 2052156
DescriptionDomain of unknown function (DUF303)
View CDS
External Links
NCBI Taxonomy
Plaza
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
CE61402227e-25
  DDPLVLGLVPCAVGGTRIWMWARGQPLYEAAVVRTRAAVADGGGTLGAVLWFQGESDTIEMDDARSYGGKMERLVADLRADLG
Full Sequence
Protein Sequence     Length: 301     Download
MKPARRPLLG ALAAAALLSF LLILDPPGGL LVLFPSSLVR SSPYAHRPKL LFLLAGQSNM    60
AGRGALPASL PPPYATHPRI LRLSAARRWV AASPPLHADI DTHKTCGLGP AMPFAHRVLS    120
SVSADSAPSS VSDPGAASDD DPLVLGLVPC AVGGTRIWMW ARGQPLYEAA VVRTRAAVAD    180
GGGTLGAVLW FQGESDTIEM DDARSYGGKM ERLVADLRAD LGLPNLLVIQ VGLASGEGNY    240
TDIVREAQKN INLPNVILVD AMGLPLRDDQ LHLSTEAQLQ LGDMLAQAYL EFNSSRERRL    300
*                                                                    360
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
pfam03629DUF3036.0e-3151290285+
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
EMBLCAE01778.203329632278OSJNBa0027H06.16 [Oryza sativa (japonica cultivar-group)]
EMBLCAH67782.103329632278H0201G08.9 [Oryza sativa (indica cultivar-group)]
GenBankEEC76648.103329635281hypothetical protein OsI_14598 [Oryza sativa Indica Group]
GenBankEEE60387.103329635281hypothetical protein OsJ_13540 [Oryza sativa Japonica Group]
RefSeqXP_002446042.103029939292hypothetical protein SORBIDRAFT_06g000860 [Sorghum bicolor]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB2apj_D04829021256A Chain A, X-Ray Structure Of Protein From Arabidopsis Thaliana At4g34215 At 1.6 Angstrom Resolution
PDB2apj_C04829021256A Chain A, X-Ray Structure Of Protein From Arabidopsis Thaliana At4g34215 At 1.6 Angstrom Resolution
PDB2apj_B04829021256A Chain A, X-Ray Structure Of Protein From Arabidopsis Thaliana At4g34215 At 1.6 Angstrom Resolution
PDB2apj_A04829021256A Chain A, X-Ray Structure Of Protein From Arabidopsis Thaliana At4g34215 At 1.6 Angstrom Resolution
PDB1zmb_F3e-19522905225A Chain A, Crystal Structure Of The Putative Acetylxylan Esterase From Clostridium Acetobutylicum, Northeast Structural Genomics Target Car6
Transmembrane Domains
StartEnd
724
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
EG382539244262660
DV4905301981022990
AI9478791921082990
CN1399871551452990
FQ444680252462900
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_007_00771.1Aquca_007_00771.2Aquca_083_00065.1Aquca_007_00769.2Aquca_007_00769.1
Aquca_083_00064.1
Arabidopsis lyrata491251485676
Arabidopsis thalianaAT4G34215.2AT4G34215.1AT3G53010.1
Brachypodium distachyonBradi1g00920.1Bradi5g03767.1
Brassica rapaBra019633Bra011507Bra006967
Carica papayaevm.model.supercontig_21.147evm.model.supercontig_106.87
Capsella rubellaCarubv10017718m
Citrus clementinaCiclev10029126mCiclev10001964m
Citrus sinensisorange1.1g031029morange1.1g041680m
Cucumis sativusCucsa.219410.1Cucsa.352550.1Cucsa.363600.1Cucsa.395900.1Cucsa.118670.1
Cucsa.131470.1Cucsa.395910.1
Eucalyptus grandisEucgr.F02296.1Eucgr.F02295.1Eucgr.F00179.1Eucgr.F02298.1Eucgr.H03219.1
Fragaria vescamrna26277.1-v1.0-hybridmrna00187.1-v1.0-hybridmrna00186.1-v1.0-hybrid
Glycine maxGlyma04g04480.1Glyma06g04600.2Glyma20g26520.1Glyma14g09520.2
Gossypium raimondiiGorai.009G215800.2Gorai.009G215800.1Gorai.009G276300.1Gorai.002G009200.3Gorai.002G009200.2
Gorai.002G009200.1Gorai.010G023400.1Gorai.010G023300.1
Linum usitatissimumLus10014097Lus10019817Lus10001129Lus10001128Lus10042634
Malus domesticaMDP0000268373MDP0000232743MDP0000659790
Manihot esculentacassava4.1_017032mcassava4.1_014751mcassava4.1_012755mcassava4.1_028741mcassava4.1_023715m
Medicago truncatulaMedtr3g102390.1Medtr1g018750.1Medtr4g031010.1
Mimulus guttatusmgv1a011596mmgv1a011640mmgv1a012327mmgv1a011466mmgv1a024902m
mgv1a012748m
Oryza sativaLOC_Os03g64030.1LOC_Os04g20810.3LOC_Os04g20810.2LOC_Os04g20810.1LOC_Os03g64050.1
LOC_Os04g01980.1
Panicum virgatumPavirv00050725mPavirv00054854mPavirv00001245mPavirv00015379mPavirv00041774m
Pavirv00024018mPavirv00052298m
Physcomitrella patensPp1s22_274V6.1
Phaseolus vulgarisPhvul.009G067900.1Phvul.007G040500.1Phvul.001G025100.1
Picea abiesMA_10266583g0010MA_10429498g0010
Populus trichocarpaPotri.001G300800.2Potri.001G300800.1Potri.009G096400.2Potri.009G096400.1Potri.014G022600.1
Potri.014G022700.2Potri.014G022700.1
Prunus persicappa018867mppa010380mppa015335m
Ricinus communis30170.m01421430170.m01378629801.m003105
Setaria italicaSi037070mSi018083mSi037046mSi018268mSi037217m
Si010984mSi010752m
Selaginella moellendorffii122285
Sorghum bicolorSb02g011020.1Sb01g000550.1Sb01g000530.1Sb06g006110.1Sb06g000860.1
Thellungiella halophilaThhalv10026018mThhalv10010602m
Vitis viniferaGSVIVT01003163001GSVIVT01009426001GSVIVT01009427001
Zea maysAC203966.5_FGT003
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)