y PlantCAZyme

CAZyme Information

Basic Information
SpeciesBrachypodium distachyon
Cazyme IDBradi5g02350.1
FamilyGT43
Protein PropertiesLength: 397 Molecular Weight: 43865.9 Isoelectric Point: 9.5842
ChromosomeChromosome/Scaffold: 5 Start: 2466541 End: 2469382
DescriptionNucleotide-diphospho-sugar transferases superfamily protein
View CDS
External Links
NCBI Taxonomy
Plaza
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GT431583700
  MGQTLRLARPPVLWVVVEAGKPTPEAAHALRRTAVMHRYVGCCDKLAAAANANASIDYRPHQMNAGLEVVENHRLDGIVYFADEEGVYSLQLFDRLRQIR
  RFGTWPVPVISDGGNGVVLDGPVCKQNQVVGWHTSGEASKLQRFHVAMSGFAFNSTMLWDPKLRSHQAWNSIRHPEMVEQGFQGTAFVEQLVEDESQMEG
  IPADCSQIMNWHV
Full Sequence
Protein Sequence     Length: 397     Download
MASIRRPHSP AKQQHLLRHH HPFASSSPPS SPLRHASSAA TTSSSPRHHH GGSYPHPFLF    60
FTRRPLPRFA AFFLLGSFLG LLHFLSHLPL LPHLPVPTNA SSSSPQFNHL QQQPALDQQQ    120
QATTLGLGGG GENNGDKLLI VVTPTRARAS QAYYLSRMGQ TLRLARPPVL WVVVEAGKPT    180
PEAAHALRRT AVMHRYVGCC DKLAAAANAN ASIDYRPHQM NAGLEVVENH RLDGIVYFAD    240
EEGVYSLQLF DRLRQIRRFG TWPVPVISDG GNGVVLDGPV CKQNQVVGWH TSGEASKLQR    300
FHVAMSGFAF NSTMLWDPKL RSHQAWNSIR HPEMVEQGFQ GTAFVEQLVE DESQMEGIPA    360
DCSQIMNWHV PFGSESLVYP KGWRVATNLD VIIPLK*                             420
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
PLN02458PLN024589.0e-52140372240+
pfam03360Glyco_transf_437.0e-53158369217+
cd00218GlcAT-I8.0e-69140369234+
Gene Ontology
GO TermDescription
GO:0015018galactosylgalactosylxylosylprotein 3-beta-glucuronosyltransferase activity
GO:0016020membrane
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
EMBLCAE12013.1013639618276beta3-glucuronyltransferase [Hordeum vulgare]
EMBLCAH65757.1013961381OSIGBa0123D13.6 [Oryza sativa (indica cultivar-group)]
RefSeqNP_001051997.1013961381Os04g0103100 [Oryza sativa (japonica cultivar-group)]
RefSeqNP_001131482.1013961387hypothetical protein LOC100192819 [Zea mays]
RefSeqXP_002446005.1013961385hypothetical protein SORBIDRAFT_06g000430 [Sorghum bicolor]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB1v84_B7e-211413697230A Chain A, Crystal Structure Of A 6-Sst6-Sft From Pachysandra Terminalis
PDB1v84_A7e-211413697230A Chain A, Crystal Structure Of A 6-Sst6-Sft From Pachysandra Terminalis
PDB1v83_B7e-211413697230A Chain A, Crystal Structure Of A 6-Sst6-Sft From Pachysandra Terminalis
PDB1v83_A7e-211413697230A Chain A, Crystal Structure Of A 6-Sst6-Sft From Pachysandra Terminalis
PDB1v82_B7e-211413697230A Chain A, Crystal Structure Of Human Glcat-P Apo Form
Transmembrane Domains
StartEnd
6991
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
DT6463012291403640
EE0462691892123970
BU9988741681403070
DR1640492571403960
GR1833302491403880
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_007_00731.2Aquca_007_00731.1Aquca_001_00368.3Aquca_001_00368.2Aquca_001_00368.1
Aquca_010_00019.1Aquca_027_00094.1
Arabidopsis lyrata912627496876890287902844
Arabidopsis thalianaAT5G67230.1AT4G36890.1AT1G27600.2AT1G27600.1AT2G37090.1
Brachypodium distachyonBradi1g33320.3Bradi1g33320.2Bradi1g33320.1Bradi5g24290.1Bradi3g23120.1
Bradi2g00290.1Bradi2g46410.1Bradi2g16840.1Bradi1g16540.1Bradi1g65750.1
Bradi1g16540.2Bradi2g37970.3Bradi2g37970.1
Brassica rapaBra012145Bra011745Bra010929Bra030055Bra005218
Carica papayaevm.model.supercontig_55.103evm.model.supercontig_7.258evm.model.supercontig_366.2evm.model.supercontig_286.11
Capsella rubellaCarubv10004588mCarubv10027753mCarubv10009365mCarubv10025381mCarubv10025384m
Citrus clementinaCiclev10025401mCiclev10008306mCiclev10008305mCiclev10008303mCiclev10001397m
Ciclev10012036m
Citrus sinensisorange1.1g013985morange1.1g010452morange1.1g013438morange1.1g013414morange1.1g016070m
orange1.1g016052morange1.1g042066m
Cucumis sativusCucsa.102610.2Cucsa.102610.1Cucsa.312290.4Cucsa.312610.1Cucsa.312290.3
Cucsa.312290.2Cucsa.312290.1.175.269Cucsa.312290.1.175.269Cucsa.307090.2Cucsa.307090.1
Cucsa.312290.1.357.476Cucsa.312290.1.357.476
Eucalyptus grandisEucgr.I00880.2Eucgr.I00880.1Eucgr.H02219.1Eucgr.C00584.1Eucgr.F00463.3
Eucgr.F00463.2Eucgr.F00463.1Eucgr.F02177.3Eucgr.F02177.2Eucgr.F02177.1
Eucgr.A01172.1Eucgr.K03214.1
Fragaria vescamrna23860.1-v1.0-hybridmrna09635.1-v1.0-hybridmrna08813.1-v1.0-hybridmrna26845.1-v1.0-hybrid
Glycine maxGlyma17g18450.2Glyma17g18450.1Glyma16g16280.1Glyma11g05640.1Glyma01g39610.1
Glyma05g20910.2Glyma06g08820.1Glyma04g08720.2Glyma04g08720.1Glyma03g33570.1
Glyma19g36280.1Glyma10g05730.2Glyma10g05730.1Glyma13g20080.1Glyma13g20080.2
Glyma06g09560.1Glyma04g09470.2
Gossypium raimondiiGorai.007G216800.2Gorai.007G216800.1Gorai.003G026800.1Gorai.004G051000.1Gorai.004G051100.1
Gorai.004G290300.4Gorai.004G290300.3Gorai.004G290300.2Gorai.004G290300.1Gorai.009G051500.3
Gorai.009G051500.2Gorai.009G051500.1Gorai.005G097300.3Gorai.005G097300.2Gorai.005G097300.1
Gorai.002G137600.1Gorai.006G168500.1Gorai.010G031000.2Gorai.010G031000.1Gorai.006G168500.2
Linum usitatissimumLus10010268Lus10041601Lus10011500Lus10019325Lus10032817
Lus10007692Lus10019917Lus10026487Lus10015069
Malus domesticaMDP0000186002MDP0000308871MDP0000207693MDP0000287243MDP0000666177
MDP0000703247MDP0000259253MDP0000487987MDP0000131594MDP0000126039
MDP0000130817
Manihot esculentacassava4.1_006028mcassava4.1_006067mcassava4.1_008517mcassava4.1_007765mcassava4.1_008594m
cassava4.1_031170mcassava4.1_029083m
Medicago truncatulaMedtr5g016600.1AC225517_17.1Medtr3g111060.1Medtr7g100800.1
Mimulus guttatusmgv1a004664mmgv1a008341mmgv1a011740mmgv1a020319mmgv1a007326m
mgv1a007301mmgv1a010149mmgv1a009864m
Oryza sativaLOC_Os06g47340.1LOC_Os04g55670.1LOC_Os10g13810.1LOC_Os03g17850.1LOC_Os01g48440.1
LOC_Os01g48440.3LOC_Os01g48440.2LOC_Os05g48600.2LOC_Os05g48600.1LOC_Os01g06450.1
LOC_Os04g01280.1LOC_Os05g03174.2LOC_Os05g03174.1LOC_Os07g49370.1
Panicum virgatumPavirv00070690mPavirv00002442mPavirv00049605mPavirv00049604mPavirv00066013m
Pavirv00015553mPavirv00048742mPavirv00020159mPavirv00023302mPavirv00014028m
Pavirv00068635mPavirv00020160mPavirv00041023mPavirv00041022mPavirv00069320m
Pavirv00069319mPavirv00064679mPavirv00025005mPavirv00063696mPavirv00054446m
Pavirv00038884mPavirv00043409mPavirv00036401m
Physcomitrella patensPp1s248_13V6.1Pp1s78_128V6.1Pp1s19_221V6.1Pp1s1_540V6.1Pp1s52_108V6.1
Phaseolus vulgarisPhvul.002G016000.1Phvul.009G107900.2Phvul.009G107900.1Phvul.001G175200.1Phvul.007G164400.2
Phvul.009G146400.1Phvul.007G164400.1
Picea abiesMA_10433413g0010MA_9135945g0010MA_10426088g0010MA_42440g0010
Populus trichocarpaPotri.007G047500.2Potri.007G047500.1Potri.005G141500.1Potri.002G107300.3Potri.002G107300.2
Potri.002G107300.1Potri.006G240200.1Potri.006G240200.2Potri.006G131000.2Potri.006G131000.1
Potri.016G086400.1Potri.018G039900.1
Prunus persicappa004411mppa005926mppa006476mppa007640m
Ricinus communis29794.m00343730170.m01362129805.m001478
Setaria italicaSi006224mSi010088mSi002282mSi036401mSi001449m
Si022019mSi010329mSi010328mSi005128mSi030381m
Si022408m
Selaginella moellendorffii1208278265416278
Sorghum bicolorSb10g027970.1Sb06g030810.1Sb03g011010.1Sb09g028220.1Sb03g030990.1
Sb06g000430.1Sb01g038640.1Sb03g005410.1Sb09g002200.1Sb02g044020.1
Thellungiella halophilaThhalv10024924mThhalv10004084mThhalv10007547mThhalv10016877m
Vitis viniferaGSVIVT01022064001GSVIVT01035647001GSVIVT01025636001GSVIVT01009245001
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)