y PlantCAZyme

CAZyme Information

Basic Information
SpeciesBrachypodium distachyon
Cazyme IDBradi5g03400.1
FamilyGT1
Protein PropertiesLength: 457 Molecular Weight: 49525.2 Isoelectric Point: 7.7732
ChromosomeChromosome/Scaffold: 5 Start: 3955498 End: 3960273
DescriptionUDP-glucosyl transferase 74D1
View CDS
External Links
NCBI Taxonomy
Plaza
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GT11144362.8e-37
  YTLSTTPPPDAPFRVAAISDGFDDGGKPSGPDMTEYLRRLEAVGSDTLARLLSDEARAGRPVRVLVYDPHVSWARRVARDAGVPAAAFFSQPCAVNIFYG
  EVHAGRMAMPVTESDACALVGGGTLGVELRPEDLPPFVALPEWHPVFTKTSIRQFDGLEDADDVLVNSFRDLEPTLEELGNGLYSSGKRFLWVVRSDEAH
  KLSQELKTKCEKKGLIVPWCPQLEVLAHKATGCFLTHCGWNSTLEAISNGVPLVGIPHWGDQPTIAKYMESAWDMGVRVQTGLNGQVRREEVVRCIKQVM
  DGERKDEYKRNAMKWMQKAKEAM
Full Sequence
Protein Sequence     Length: 457     Download
MATCSRATIS SSLAPLPIRM SSVLNTSAVL SSRTTDRTHL GRSTSASPLV AAAREAGTCR    60
TGTGSSVAHE GGEGANVFFL PVPGAQGHTN PMLQFGRRLA YQYGFRPTLV VSSYTLSTTP    120
PPDAPFRVAA ISDGFDDGGK PSGPDMTEYL RRLEAVGSDT LARLLSDEAR AGRPVRVLVY    180
DPHVSWARRV ARDAGVPAAA FFSQPCAVNI FYGEVHAGRM AMPVTESDAC ALVGGGTLGV    240
ELRPEDLPPF VALPEWHPVF TKTSIRQFDG LEDADDVLVN SFRDLEPTLE ELGNGLYSSG    300
KRFLWVVRSD EAHKLSQELK TKCEKKGLIV PWCPQLEVLA HKATGCFLTH CGWNSTLEAI    360
SNGVPLVGIP HWGDQPTIAK YMESAWDMGV RVQTGLNGQV RREEVVRCIK QVMDGERKDE    420
YKRNAMKWMQ KAKEAMHTGG SSNKHIADFA TKYSSS*                             480
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
PLN02555PLN025553.0e-1777289225+
PLN02173PLN021734.0e-3276292220+
PLN02173PLN021739.0e-48289455169+
PLN02555PLN025552.0e-50289452172+
PLN02152PLN021521.0e-5078449449+
Gene Ontology
GO TermDescription
GO:0008152metabolic process
GO:0016758transferase activity, transferring hexosyl groups
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankADC92550.107745527474UDP-glucosyltransferase HvUGT13248 [Hordeum vulgare subsp. vulgare]
EMBLCAD40017.20693527335OSJNBa0052O21.2 [Oryza sativa (japonica cultivar-group)]
GenBankEAZ29756.106545513425hypothetical protein OsJ_13815 [Oryza sativa Japonica Group]
GenBankEAZ29769.10614347378hypothetical protein OsJ_13827 [Oryza sativa Japonica Group]
RefSeqNP_001052235.106545544463Os04g0204100 [Oryza sativa (japonica cultivar-group)]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB2pq6_A2e-31289452313480A Chain A, Crystal Structure Of Medicago Truncatula Ugt85h2- Insights Into The Structural Basis Of A Multifunctional (Iso) Flavonoid Glycosyltransferase
PDB2pq6_A0.0057628610238A Chain A, Crystal Structure Of Medicago Truncatula Ugt85h2- Insights Into The Structural Basis Of A Multifunctional (Iso) Flavonoid Glycosyltransferase
PDB2vg8_A8e-29289455286469A Chain A, Crystal Structure Of Medicago Truncatula Ugt85h2- Insights Into The Structural Basis Of A Multifunctional (Iso) Flavonoid Glycosyltransferase
PDB2vch_A8e-29289455286469A Chain A, Crystal Structure Of Medicago Truncatula Ugt85h2- Insights Into The Structural Basis Of A Multifunctional (Iso) Flavonoid Glycosyltransferase
Metabolic Pathways
Pathway NameReactionECProtein Name
crocetin esters biosynthesisRXN-8471EC-2.4.1.271crocetin glucosyltransferase
crocetin esters biosynthesisRXN-8473EC-2.4.1.271crocetin glucosyltransferase
crocetin esters biosynthesisRXN-8475EC-2.4.1.271crocetin glucosyltransferase
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
DV4885581642864490
GR316309230632900
DV4879001562864410
AJ4333331672894550
HX0804051672894550
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_083_00035.1Aquca_032_00010.1Aquca_083_00040.1Aquca_066_00059.1Aquca_002_00093.1
Aquca_002_00095.1Aquca_014_00200.1Aquca_002_00304.1Aquca_015_00237.1Aquca_058_00020.1
Aquca_015_00236.1Aquca_083_00033.1Aquca_045_00003.1Aquca_014_00201.1Aquca_042_00011.1
Aquca_034_00091.1Aquca_034_00094.1Aquca_083_00034.1
Arabidopsis lyrata470571481198900805483500902214
482098889955470572483498887739
887744493341493342479675493340
915488493327915253
Arabidopsis thalianaAT1G05675.1AT1G05680.1AT2G43840.2AT2G43840.1AT2G23250.1
AT2G31790.1AT1G24100.1AT2G31750.1AT2G43820.1AT1G05560.1
AT1G05530.1AT4G15490.1AT3G21560.1AT4G15480.1AT4G14090.1
AT4G15500.1AT4G15550.1AT2G23260.1
Brachypodium distachyonBradi3g06487.1Bradi5g03300.1Bradi5g03390.1Bradi1g37030.1Bradi2g17320.1
Bradi4g35342.1Bradi4g35350.1Bradi5g02780.1Bradi5g03380.1Bradi5g03370.1
Bradi4g35356.1Bradi5g03320.1Bradi1g37050.1Bradi3g07557.1Bradi2g05042.1
Bradi2g05050.1Bradi2g46820.1Bradi4g42997.1Bradi2g12347.1Bradi2g33940.1
Bradi4g26560.1Bradi1g11940.1
Brassica rapaBra022864Bra000330Bra000329Bra039192Bra021743
Bra005641Bra030620Bra015448Bra021740Bra024634
Bra004787Bra004788Bra031483Bra038445Bra017882
Bra039547Bra012784Bra039545Bra031290Bra023872
Bra015435Bra039544Bra039191Bra032179Bra033494
Bra038080Bra038079
Carica papayaevm.model.supercontig_6.92evm.model.supercontig_1205.2evm.model.supercontig_1205.3evm.model.supercontig_106.99evm.model.supercontig_601.4
evm.model.supercontig_5.342evm.model.supercontig_5.341evm.model.supercontig_157.30
Capsella rubellaCarubv10010859mCarubv10025112mCarubv10006803mCarubv10023202mCarubv10025420m
Carubv10009070mCarubv10023181mCarubv10025301mCarubv10009096mCarubv10024869m
Carubv10011842mCarubv10009073mCarubv10013531mCarubv10025476mCarubv10024992m
Carubv10007541mCarubv10007399mCarubv10004723mCarubv10004716mCarubv10028525m
Carubv10007186mCarubv10007134mCarubv10007692m
Citrus clementinaCiclev10015147mCiclev10018164mCiclev10015138mCiclev10028247mCiclev10015145m
Ciclev10023826mCiclev10020081mCiclev10015140mCiclev10017682mCiclev10020092m
Ciclev10015155mCiclev10015149mCiclev10031201mCiclev10028293mCiclev10017665m
Ciclev10023445mCiclev10027383mCiclev10004909mCiclev10019912mCiclev10017641m
Citrus sinensisorange1.1g038830morange1.1g012194morange1.1g012645morange1.1g012412morange1.1g048393m
orange1.1g012277morange1.1g046339morange1.1g036740morange1.1g041902morange1.1g045998m
orange1.1g035557morange1.1g036519m
Cucumis sativusCucsa.219460.1Cucsa.073120.1Cucsa.184880.1Cucsa.156270.1Cucsa.345960.1
Cucsa.149960.1Cucsa.327680.1Cucsa.327670.1Cucsa.389830.1Cucsa.149970.1
Cucsa.345950.1Cucsa.327660.1Cucsa.345990.1Cucsa.120520.1Cucsa.120500.1
Cucsa.219470.1Cucsa.135920.1Cucsa.120510.1
Eucalyptus grandisEucgr.G01348.1Eucgr.K02352.1Eucgr.K02355.1Eucgr.K02355.2Eucgr.K02356.1
Eucgr.G01344.1Eucgr.H00503.1Eucgr.H00279.1Eucgr.H00694.1Eucgr.H00275.1
Eucgr.H00277.1Eucgr.H00692.1Eucgr.H00266.1Eucgr.H00263.1Eucgr.H00273.1
Eucgr.K02353.1Eucgr.B02563.1Eucgr.H00270.1Eucgr.H00268.1Eucgr.H00261.1
Eucgr.H00695.1Eucgr.H00261.2Eucgr.L03174.1Eucgr.G01342.1Eucgr.I01103.1
Eucgr.K02875.1Eucgr.H00262.1Eucgr.H00697.1Eucgr.H02643.1Eucgr.H02640.1
Eucgr.L00635.1Eucgr.L00636.1Eucgr.H02641.1Eucgr.H00691.1Eucgr.H02638.1
Eucgr.L00634.1Eucgr.H00004.1Eucgr.H02644.1Eucgr.H02642.1Eucgr.L01046.1
Eucgr.L00631.1Eucgr.L00632.1Eucgr.L01047.1Eucgr.D01218.1Eucgr.H02639.1
Eucgr.H00001.1Eucgr.H00502.1Eucgr.H00007.1Eucgr.C04261.1Eucgr.H00698.1
Fragaria vescamrna25367.1-v1.0-hybridmrna25368.1-v1.0-hybridmrna22460.1-v1.0-hybridmrna25361.1-v1.0-hybridmrna01800.1-v1.0-hybrid
mrna25363.1-v1.0-hybridmrna09479.1-v1.0-hybridmrna17480.1-v1.0-hybridmrna10134.1-v1.0-hybridmrna00708.1-v1.0-hybrid.714.883
mrna00708.1-v1.0-hybrid.714.883mrna00708.1-v1.0-hybrid.262.422mrna00708.1-v1.0-hybrid.262.422mrna06602.1-v1.0-hybridmrna06600.1-v1.0-hybrid
mrna29832.1-v1.0-hybridmrna06601.1-v1.0-hybridmrna26265.1-v1.0-hybridmrna06599.1-v1.0-hybridmrna26479.1-v1.0-hybrid
mrna22459.1-v1.0-hybridmrna26249.1-v1.0-hybrid
Glycine maxGlyma09g38140.2Glyma08g13230.1Glyma01g04250.1Glyma19g03010.1Glyma16g27440.1
Glyma09g38130.1Glyma13g24230.1Glyma02g03420.1Glyma19g03000.2Glyma18g48230.1
Glyma13g05580.1Glyma18g48250.1Glyma13g05590.1Glyma08g11330.1Glyma17g18220.2
Glyma05g28330.1Glyma05g28340.1Glyma18g00620.1Glyma10g40900.1Glyma20g26420.1
Glyma13g05601.1
Gossypium raimondiiGorai.005G234600.1.57.433Gorai.005G234600.1.57.433Gorai.001G226600.1Gorai.001G226500.1Gorai.002G164900.2
Gorai.002G164900.1Gorai.009G344800.1Gorai.011G131200.1Gorai.003G157800.1Gorai.009G328300.1
Gorai.005G007900.1Gorai.005G008000.1Gorai.005G008100.1Gorai.005G234600.1.545.898Gorai.005G234600.1.545.898
Gorai.011G176600.1Gorai.005G234700.1Gorai.005G025400.1Gorai.005G025500.1Gorai.005G025600.1
Gorai.005G025700.1Gorai.005G026200.1Gorai.005G025900.1Gorai.003G047900.1Gorai.007G218400.1
Gorai.005G026100.1
Linum usitatissimumLus10006352Lus10017825Lus10006353Lus10024118Lus10014148
Lus10009412Lus10010468Lus10006351Lus10008742Lus10006721
Lus10003809Lus10020559Lus10024486Lus10010712Lus10020556
Lus10024117Lus10024834Lus10039041Lus10029197Lus10027862
Lus10021610Lus10006720.10.141Lus10006720.10.141Lus10014105Lus10019808
Lus10019809Lus10015515Lus10019989Lus10040591Lus10010469
Lus10010467Lus10029466
Malus domesticaMDP0000125167MDP0000143804MDP0000250047MDP0000267341MDP0000250223
MDP0000684216MDP0000891353MDP0000150382MDP0000662428MDP0000239301
MDP0000545122MDP0000617956MDP0000158799MDP0000733506MDP0000229280
MDP0000506825MDP0000278892MDP0000718430MDP0000839414MDP0000122478
Manihot esculentacassava4.1_031168mcassava4.1_005904mcassava4.1_021903mcassava4.1_007291mcassava4.1_006987m
cassava4.1_022886mcassava4.1_024544mcassava4.1_034023mcassava4.1_024094mcassava4.1_030178m
cassava4.1_033162mcassava4.1_025968mcassava4.1_007706mcassava4.1_013962mcassava4.1_034011m
cassava4.1_031975mcassava4.1_024325mcassava4.1_006949mcassava4.1_034307mcassava4.1_007134m
cassava4.1_028982mcassava4.1_027880mcassava4.1_009833mcassava4.1_006110mcassava4.1_022255m
cassava4.1_006627m
Medicago truncatulaMedtr5g016480.1Medtr7g080950.1Medtr5g035560.1Medtr5g035580.1Medtr8g088560.1
Medtr7g080935.1Medtr7g080900.1Medtr7g080940.1Medtr3g084520.1Medtr8g083280.1
Medtr8g083290.1Medtr3g084530.1Medtr3g084540.1Medtr3g049970.1Medtr7g080960.1
Mimulus guttatusmgv1a023901mmgv1a006064mmgv1a020645mmgv1a005301mmgv1a006216m
mgv1a006158mmgv1a006214mmgv1a025741mmgv1a006023mmgv1a005398m
mgv1a018203mmgv1a005918mmgv1a026355mmgv1a026563mmgv1a007491m
mgv1a005538mmgv1a021119mmgv1a023035mmgv1a024986mmgv1a025083m
Oryza sativaLOC_Os05g47950.1LOC_Os04g12960.1LOC_Os04g12900.1LOC_Os02g10880.1LOC_Os09g34270.1
LOC_Os04g12980.1LOC_Os09g34214.1LOC_Os09g34230.1LOC_Os09g34250.1LOC_Os03g48740.1
LOC_Os04g12970.1LOC_Os04g12950.1LOC_Os04g12720.1LOC_Os02g09510.1LOC_Os01g49240.1
LOC_Os01g49230.1LOC_Os06g39330.1LOC_Os06g39270.1LOC_Os01g08440.1LOC_Os11g25990.1
LOC_Os05g08750.1LOC_Os11g04860.1
Panicum virgatumPavirv00009723mPavirv00026932mPavirv00064072mPavirv00024694mPavirv00014304m
Pavirv00059702mPavirv00067747mPavirv00012880mPavirv00037210mPavirv00002184m
Pavirv00030202mPavirv00014827mPavirv00011652mPavirv00055952mPavirv00002185m
Pavirv00026097mPavirv00046800mPavirv00027365mPavirv00049307mPavirv00046840m
Pavirv00031346mPavirv00025927mPavirv00021487mPavirv00023346mPavirv00048842m
Pavirv00063892mPavirv00058277mPavirv00063379mPavirv00050234mPavirv00003949m
Pavirv00027250mPavirv00059578mPavirv00047007mPavirv00056141mPavirv00059759m
Pavirv00065505mPavirv00037261mPavirv00066786mPavirv00035655mPavirv00026950m
Pavirv00025237mPavirv00000492mPavirv00002859mPavirv00025617mPavirv00020371m
Pavirv00020306mPavirv00013675m
Phaseolus vulgarisPhvul.007G039500.1Phvul.007G039600.1Phvul.007G039400.1Phvul.002G247700.1Phvul.002G075200.1
Phvul.011G184600.1Phvul.004G086500.1Phvul.004G029500.1Phvul.004G031100.1Phvul.004G030400.1
Phvul.009G115200.1Phvul.004G024500.1Phvul.004G031000.1Phvul.007G039300.1Phvul.001G265400.1
Phvul.003G239700.1Phvul.007G039200.1
Picea abiesMA_10268298g0010MA_634631g0010MA_49332g0010MA_732668g0010MA_310012g0010
MA_9523098g0010MA_10428368g0020MA_10433477g0020.690.861MA_10433477g0020.690.861MA_207511g0010
MA_10428919g0010MA_625682g0010MA_476822g0010MA_89176g0010MA_121428g0010
MA_143140g0010MA_12952g0010MA_10433477g0020.184.400MA_10433477g0020.184.400MA_8902024g0010
MA_10436215g0020MA_239168g0010MA_901723g0010MA_95387g0010MA_796003g0010
MA_10429829g0010
Populus trichocarpaPotri.007G049600.1Potri.007G140300.1Potri.007G141900.1Potri.009G095500.1Potri.014G175000.1
Potri.007G117200.1Potri.004G179300.1Potri.015G071900.1Potri.001G389200.1Potri.017G032500.1
Potri.017G032300.1Potri.017G032700.1Potri.007G140500.1Potri.009G095100.1Potri.009G095300.1
Potri.004G083700.1Potri.007G141700.1Potri.017G101800.1Potri.009G095400.1Potri.016G052500.1
Potri.006G055600.1Potri.007G140600.1Potri.002G236400.1Potri.009G095200.1Potri.014G146000.1
Potri.007G140700.1Potri.007G117300.1
Prunus persicappa005386mppa005475mppa020804mppa005722mppa005294m
ppa016463mppa016444mppa016883mppa026200mppa016486m
ppa005780mppa020679mppa016890mppa012496mppa021645m
ppa005161mppa024612mppa005173mppa021082mppa005187m
Ricinus communis29970.m00099229970.m00099329801.m00308829678.m00051227866.m000223
29801.m00308727866.m00022427866.m00023229736.m00211929678.m000509
29678.m00051029678.m00051129678.m00051329678.m00050829801.m003090
29801.m00308930183.m001298
Setaria italicaSi010049mSi029756mSi035595mSi008274mSi006344m
Si029769mSi006350mSi008226mSi004704mSi012087m
Si029755mSi029697mSi031926mSi010006mSi035385m
Si019285mSi001341mSi024864mSi016917mSi007900m
Si010556mSi012300m
Sorghum bicolorSb03g005340.1Sb02g030040.1Sb04g005960.1Sb06g002180.1Sb01g031560.1
Sb10g009990.1Sb02g030050.1Sb02g030030.1Sb02g030020.1Sb01g021110.1
Sb01g011390.1Sb01g031540.1Sb02g030060.1Sb03g006390.1Sb03g006410.1
Sb10g023060.1Sb03g003760.1Sb10g023120.1Sb09g027760.1Sb09g005510.1
Sb06g018240.1Sb10g023070.1Sb08g001100.1Sb05g002700.1Sb05g002710.1
Sb10g023050.1
Thellungiella halophilaThhalv10001440mThhalv10024946mThhalv10007603mThhalv10016636mThhalv10001441m
Thhalv10007574mThhalv10016638mThhalv10025167mThhalv10007593mThhalv10007589m
Thhalv10025056mThhalv10020520mThhalv10025072mThhalv10025055mThhalv10027288m
Thhalv10000612mThhalv10000540mThhalv10000452mThhalv10000436mThhalv10027441m
Vitis viniferaGSVIVT01038200001GSVIVT01038207001GSVIVT01005733001GSVIVT01038204001GSVIVT01038206001
GSVIVT01038203001GSVIVT01031615001GSVIVT01020177001GSVIVT01031600001GSVIVT01031580001
Zea maysAC199541.4_FGT002AC199541.4_FGT001AC199541.4_FGT004AC199541.4_FGT007
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)