y PlantCAZyme

CAZyme Information

Basic Information
SpeciesBrachypodium distachyon
Cazyme IDBradi5g06647.1
FamilyGT41
Protein PropertiesLength: 1014 Molecular Weight: 113211 Isoelectric Point: 6.503
ChromosomeChromosome/Scaffold: 5 Start: 8719901 End: 8737672
DescriptionTetratricopeptide repeat (TPR)-like superfamily protein
View CDS
External Links
NCBI Taxonomy
Plaza
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GT417929980
  PHKRSDYGLPEDKFIFACFNQLYKMDPEIFDTWCNIVKRVPNSVLWLLRFPATGEMRVKAHAAARGVSPDQIIFTDVAVKHEHIRRSELADLFLDTPLCN
  AHTTGTDILWAGLPMITLALEKMATRVAGSLCLATGLGDEMIVSSTKEYEDRAVELATNPAELRILTNKLKQARLTCPLFDTARWVRNLDRAYFKMWNLY
  CSGRHPE
GT416217810
  AQGKHGRLRVGYVSSDFGNHPLSHLMGSVFGMHDGNYVEVFCYALSQNDGTEWRQRIQAEAEHFIDVSAMTSDVIAKMINEDKIQILINLNGYTKGARNE
  IFALQPAPIQVSYMGFPGTTGASYIDYLVTDEFVSPTRYAHIYSEKLVHLPHCYFVNDYKQ
Full Sequence
Protein Sequence     Length: 1014     Download
MLSLRSDARH LAVPGRDDAW IGISGGTGVA PDGPAPAATL LLAPVFLDAR TNQLVAGVLA    60
VSIRVETGAR CADCGEPIRG MCGVATVDEE GHLALAHQNY RTGKYRQALE HAKAVYEKNP    120
RRTDNLLLLG AIYFQLRDYD LCISKNEEAL AVDPGFAECY GNMANAWKEK GDIDLAICYY    180
LTAIKIRSNF CDAWSNLASA YTRKGRLHDA AQCCRQALIL NPRLVDAHSN LGNLMKAQGF    240
VEEAYTCYLE AIRIDPHFAI AWSNLAGLFM EVGDLNKAMQ YYKEAVKLNP SFADAHLNQG    300
NVYKAMGMLE EAIACYQRAL QARPDYAMAY GNLATIYYEQ RQLDMSIHCY SQAILCDPRF    360
VEAHNNMGNA LKDAGRVEEA INCFQSCLIL QANHPQALTN LGNIYMEWNM ASAAASFYKA    420
AIAVTSGLTS PFNNLAVIYK QQGSYADAIA CYTEVLRIDP TAADALVNRG NTFKEFGRVA    480
EAIQDYMQAA TIMPTMAEAH ANLASAYKDS GNQESAITSY KKALCLRPDF PEVTCNLLHT    540
LQSVCDWENR ETMFHEVEEI IKRQIKMSLL PSVQPFHAIA YPIDPMLALE ISRKYAVQCS    600
LIASRFGLPP FVHPPPLPVR AQGKHGRLRV GYVSSDFGNH PLSHLMGSVF GMHDGNYVEV    660
FCYALSQNDG TEWRQRIQAE AEHFIDVSAM TSDVIAKMIN EDKIQILINL NGYTKGARNE    720
IFALQPAPIQ VSYMGFPGTT GASYIDYLVT DEFVSPTRYA HIYSEKLVHL PHCYFVNDYK    780
QKNRDVFSPL CPHKRSDYGL PEDKFIFACF NQLYKMDPEI FDTWCNIVKR VPNSVLWLLR    840
FPATGEMRVK AHAAARGVSP DQIIFTDVAV KHEHIRRSEL ADLFLDTPLC NAHTTGTDIL    900
WAGLPMITLA LEKMATRVAG SLCLATGLGD EMIVSSTKEY EDRAVELATN PAELRILTNK    960
LKQARLTCPL FDTARWVRNL DRAYFKMWNL YCSGRHPESF KVKEDDNEFP YDR*          1020
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
pfam13844Glyco_transf_412.0e-74795988194+
COG3914Spy4.0e-105433991568+
Gene Ontology
GO TermDescription
GO:0005515protein binding
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankACN26645.1051013191009unknown [Zea mays]
DDBJBAD21873.1084101373953putative O-linked N-acetyl glucosamine transferase [Oryza sativa Japonica Group]
GenBankEEC73199.10841013731004hypothetical protein OsI_07263 [Oryza sativa Indica Group]
GenBankEEE57013.10841013731004hypothetical protein OsJ_06783 [Oryza sativa Japonica Group]
RefSeqXP_002453843.1051013211011hypothetical protein SORBIDRAFT_04g019560 [Sorghum bicolor]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB4gz6_D03947798390A Chain A, The Structure Of Ascorbate Peroxidase Compound Ii
PDB4gz6_D0776998495716A Chain A, The Structure Of Ascorbate Peroxidase Compound Ii
PDB4gz6_D2e-2719233410152A Chain A, The Structure Of Ascorbate Peroxidase Compound Ii
PDB4gz6_D3e-262223726156A Chain A, The Structure Of Ascorbate Peroxidase Compound Ii
PDB4gz6_D1e-231542986150A Chain A, The Structure Of Ascorbate Peroxidase Compound Ii
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
HO79524746155410140
HO77872545056510140
GT0341503276619870
GO8815533256299530
HO795247525025530.0000000000005
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_058_00216.4.161.321Aquca_058_00216.4.161.321Aquca_058_00216.3.387.547Aquca_058_00216.3.387.547Aquca_058_00216.2
Aquca_058_00216.1.601.761Aquca_058_00216.1.601.761Aquca_072_00077.2Aquca_072_00077.3Aquca_072_00077.1
Arabidopsis lyrata896453.457.745896453.457.745478494
Arabidopsis thalianaAT3G04240.1.457.745AT3G04240.1.457.745AT3G11540.1AT3G11540.2
Brachypodium distachyonBradi3g43577.3.610.769Bradi3g43577.3.610.769Bradi3g43577.2Bradi3g43577.1Bradi5g06647.1.621.781
Bradi5g06647.1.621.781Bradi2g58616.1.592.750Bradi2g58616.1.592.750Bradi3g42910.1
Brassica rapaBra040144.586.743Bra040144.586.743Bra001408Bra034832
Carica papayaevm.model.supercontig_51.46.234.522evm.model.supercontig_51.46.234.522
Capsella rubellaCarubv10012900m.457.745Carubv10012900m.457.745Carubv10013012mCarubv10012928m
Chlamydomonas reinhardtiig13482.t1
Citrus clementinaCiclev10018711m.453.741Ciclev10018711m.453.741Ciclev10011210mCiclev10011021m
Citrus sinensisorange1.1g003557m.291.579orange1.1g003557m.291.579orange1.1g002729m.402.690orange1.1g002729m.402.690orange1.1g002431m.402.690
orange1.1g002431m.402.690orange1.1g005626morange1.1g005594morange1.1g004753morange1.1g007075m
orange1.1g002273morange1.1g003891morange1.1g002443morange1.1g002441morange1.1g002438m
orange1.1g006937morange1.1g007634m
Cucumis sativusCucsa.027630.1.563.753Cucsa.027630.1.563.753Cucsa.083560.1
Eucalyptus grandisEucgr.L00641.1.550.718Eucgr.L00641.1.550.718Eucgr.K02568.1
Fragaria vescamrna16720.1-v1.0-hybrid.551.739mrna16720.1-v1.0-hybrid.551.739mrna15637.1-v1.0-hybrid
Glycine maxGlyma10g31190.2Glyma10g31190.1.468.756Glyma10g31190.1.468.756Glyma20g36330.1.468.756Glyma20g36330.1.468.756
Glyma20g36330.2Glyma19g38241.2Glyma19g38241.1Glyma03g35610.3Glyma03g35610.2
Glyma02g36210.4Glyma02g36210.3Glyma10g08710.1
Gossypium raimondiiGorai.011G150500.2.480.766Gorai.011G150500.2.480.766Gorai.011G150500.1.481.772Gorai.011G150500.1.481.772Gorai.011G150500.3
Gorai.013G189100.3.376.564Gorai.013G189100.3.376.564Gorai.013G189100.2.571.758Gorai.013G189100.2.571.758Gorai.013G189100.1.571.758
Gorai.013G189100.1.571.758Gorai.011G150500.5.520.693Gorai.011G150500.5.520.693Gorai.011G150500.4.520.693Gorai.011G150500.4.520.693
Gorai.007G367900.2Gorai.007G367900.1Gorai.002G238200.2Gorai.002G238200.1
Linum usitatissimumLus10003576.450.737Lus10003576.450.737Lus10004779.456.744Lus10004779.456.744Lus10003113.456.744
Lus10003113.456.744Lus10021336Lus10017009
Malus domesticaMDP0000233292.459.747MDP0000233292.459.747MDP0000119499MDP0000212192MDP0000846748
Manihot esculentacassava4.1_001015m.583.740cassava4.1_001015m.583.740cassava4.1_002695m.313.473cassava4.1_002695m.313.473cassava4.1_002691m.313.473
cassava4.1_002691m.313.473cassava4.1_001021m.581.740cassava4.1_001021m.581.740cassava4.1_001222mcassava4.1_001239m
cassava4.1_001390m
Medicago truncatulaMedtr1g079510.2.224.512Medtr1g079510.2.224.512Medtr1g079510.1.466.754Medtr1g079510.1.466.754
Mimulus guttatusmgv1a000777m.468.756mgv1a000777m.468.756mgv1a000982m.534.691mgv1a000982m.534.691mgv1a000971m
Oryza sativaLOC_Os01g68680.1.495.747LOC_Os01g68680.1.495.747LOC_Os02g28830.1.255.415LOC_Os02g28830.1.255.415LOC_Os08g44510.1
Panicum virgatumPavirv00063187m.616.777Pavirv00063187m.616.777Pavirv00007611mPavirv00052192m
Physcomitrella patensPp1s263_4V6.1.478.766Pp1s263_4V6.1.478.766Pp1s177_132V6.1.476.764Pp1s177_132V6.1.476.764Pp1s346_18V6.1
Pp1s456_4V6.1Pp1s150_16V6.1
Phaseolus vulgarisPhvul.007G119800.1.469.757Phvul.007G119800.1.469.757Phvul.001G192300.2Phvul.001G192300.1Phvul.007G153100.2
Phvul.007G153100.1
Picea abiesMA_76964g0020.246.533MA_76964g0020.246.533MA_247226g0010.309.469MA_247226g0010.309.469MA_869746g0010
MA_475186g0010MA_261690g0010
Populus trichocarpaPotri.013G051400.7.84.372Potri.013G051400.7.84.372Potri.013G051400.6.224.512Potri.013G051400.6.224.512Potri.013G051400.5
Potri.013G051400.4.463.751Potri.013G051400.4.463.751Potri.013G051400.3.463.751Potri.013G051400.3.463.751Potri.013G051400.2.463.751
Potri.013G051400.2.463.751Potri.013G051400.1.463.751Potri.013G051400.1.463.751Potri.019G025600.5.224.512Potri.019G025600.5.224.512
Potri.019G025600.2.459.747Potri.019G025600.2.459.747Potri.019G025600.1.459.747Potri.019G025600.1.459.747Potri.019G025600.6.213.376
Potri.019G025600.6.213.376Potri.019G025600.4.417.580Potri.019G025600.4.417.580Potri.019G025600.3.478.641Potri.019G025600.3.478.641
Potri.006G208900.1Potri.016G075700.4Potri.016G075700.3Potri.016G075700.1Potri.016G075700.2
Potri.006G208900.3Potri.006G208900.2
Prunus persicappa000862m.459.747ppa000862m.459.747ppa001075m
Ricinus communis29680.m001749.589.74729680.m001749.589.74727556.m00005030032.m00047548742.m000013
Setaria italicaSi016363mSi016197m.619.779Si016197m.619.779Si000265m.480.641Si000265m.480.641
Si013329mSi013225m
Selaginella moellendorffii143846.391.643143846.391.643159012
Sorghum bicolorSb04g019560.1.619.779Sb04g019560.1.619.779Sb07g024110.1
Thellungiella halophilaThhalv10020104mThhalv10020000m.431.719Thhalv10020000m.431.719Thhalv10019996m.457.745Thhalv10019996m.457.745
Thhalv10020052mThhalv10020017m
Vitis viniferaGSVIVT01026359001.593.754GSVIVT01026359001.593.754GSVIVT01033891001
Volvox carteriVocar20006483m
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)