y PlantCAZyme

CAZyme Information

Basic Information
SpeciesBrachypodium distachyon
Cazyme IDBradi5g09170.1
FamilyGH13
Protein PropertiesLength: 861 Molecular Weight: 96281.9 Isoelectric Point: 5.0303
ChromosomeChromosome/Scaffold: 5 Start: 12406074 End: 12415848
Descriptionstarch branching enzyme 2.2
View CDS
External Links
NCBI Taxonomy
Plaza
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GH133636833.1e-31
  LPRIKRLGYNAVQIMAIQEHSYYASFGYHVTNFFAPSSRFGTPEDLKSLIDRAHELGLLVLMDIVHSHSSNNTLDGLNGFDGTDTHYFHGGPRGHHWMWD
  SRLFNYGSWEVLRFLLSNARWWLEEYKFDGFRFDGVTSMMYTHHGLQVSFTGNYGEYFGFATDVDAVVYLMLVNDMIHGLYPDAVAIGEDVSGMPTFCLP
  VQDGGVGFDYRLHMAVADKWIELLKQSDESWKMGDIVHTLTNRRWSEKCVTYAESHDQALVGDKTIAFWLMDKDMYDFMALDRPSTPRIDRGIALHKMIR
  LVTMGLGGEGYLNFMGNEFGH
Full Sequence
Protein Sequence     Length: 861     Download
MASFAVSGAT LGVVLAGSGG GGLSSTARSA RAGVDLPSLL LRKKDSSSPQ VVALLLTVGA    60
IFAFAGAVLS CAGAPGKVLV PGGGSDDLLS SAEPVSTTPA QPEESQIPED ISEQTAEAST    120
SVDAEDKLES SEPTQGIVET ITDSVTEGVK ELVVEEKPRV IQPPGDGQKI YQIDPMLEGF    180
RSHLDYRYSE YKRIRAAIDQ YEGGLDGFSR GYEKLGFIRS AEGITYREWA PGAHSAALVG    240
DFNNWNPNAD TMTRNEYGVW EIFLPNNADG SPAIPHGSRV KIRMDTPSGV KDSISAWIKF    300
SVQAPGEIPY NGIYYDPPEE EKYVFQHPQP KQPKSLRIYE SHIGMSSPEP KINTYANFRD    360
EVLPRIKRLG YNAVQIMAIQ EHSYYASFGY HVTNFFAPSS RFGTPEDLKS LIDRAHELGL    420
LVLMDIVHSH SSNNTLDGLN GFDGTDTHYF HGGPRGHHWM WDSRLFNYGS WEVLRFLLSN    480
ARWWLEEYKF DGFRFDGVTS MMYTHHGLQV SFTGNYGEYF GFATDVDAVV YLMLVNDMIH    540
GLYPDAVAIG EDVSGMPTFC LPVQDGGVGF DYRLHMAVAD KWIELLKQSD ESWKMGDIVH    600
TLTNRRWSEK CVTYAESHDQ ALVGDKTIAF WLMDKDMYDF MALDRPSTPR IDRGIALHKM    660
IRLVTMGLGG EGYLNFMGNE FGHPEWIDFP RGPQTLPNGS VLPGNNNSYD KCRRRFDLVS    720
FSCAIISSHQ GDADFLRYHG MQEFDQAMQH LEEKYGFMTS EHQYVSRKHE EDKVIIFERG    780
DLVFVFNFHW SNSFFDYRVG CSKPGKYKVA LDSDDVLFGG FSRLDHDVEY FTTEDPHDNR    840
PRSFSVYTPS RTVVVYALTE *                                              900
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
PLN02960PLN029608.0e-918026491+
PLN03244PLN032445.0e-135272859594+
PLN02447PLN024470100860765+
cd11321AmyAc_bac_euk_BE0319746429+
PLN02960PLN029600272859592+
Gene Ontology
GO TermDescription
GO:0003824catalytic activity
GO:0004553hydrolase activity, hydrolyzing O-glycosyl compounds
GO:0005975carbohydrate metabolic process
GO:0043169cation binding
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankAAG27623.1018601823AF286319_1 starch branching enzyme 2 [Triticum aestivum]
GenBankAAK26821.1018601819starch branching enzyme IIa [Aegilops tauschii]
EMBLCAA72154.10186018231,4-alpha-glucan branching enzyme II [Triticum aestivum]
EMBLCAR95900.1018601823starch branching enzyme IIa [Triticum aestivum]
EMBLCAX51366.1018601821starch branching enzyme [Hordeum vulgare subsp. vulgare]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB3amk_A01668569690A Chain A, Structure Of The Starch Branching Enzyme I (Bei) From Oryza Sativa L
PDB3aml_A01668569690A Chain A, Structure Of The Starch Branching Enzyme I (Bei) From Oryza Sativa L
PDB3vu2_B01668569690A Chain A, Structure Of The Starch Branching Enzyme I (bei) Complexed With Maltopentaose From Oryza Sativa L
PDB3vu2_A01668569690A Chain A, Structure Of The Starch Branching Enzyme I (bei) Complexed With Maltopentaose From Oryza Sativa L
PDB1m7x_D9.94922e-442108209577A Chain A, The X-Ray Crystallographic Structure Of Branching Enzyme
Metabolic Pathways
Pathway NameReactionECProtein Name
starch biosynthesisRXN-7710EC-2.4.1.181,4-α-glucan branching enzyme
Transmembrane Domains
StartEnd
426
5173
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
HO7945366971648600
HO7776386432188600
HO4581234054538570
HO4581233011584510
HO777638471732190.0000002
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_066_00053.1Aquca_027_00415.5Aquca_027_00415.4Aquca_027_00415.3Aquca_027_00415.2
Aquca_027_00415.1Aquca_015_00400.6Aquca_015_00400.5Aquca_015_00400.2Aquca_015_00400.1
Aquca_015_00400.3Aquca_015_00400.4
Arabidopsis lyrata873536321348908239
Arabidopsis thalianaAT3G20440.3AT3G20440.2AT2G36390.1AT5G03650.1
Brachypodium distachyonBradi1g41970.2Bradi1g41970.1Bradi1g29850.2Bradi1g29850.1Bradi5g09170.2
Bradi3g44760.1
Brassica rapaBra035782Bra005269Bra017241Bra009521
Carica papayaevm.model.supercontig_5.62
Capsella rubellaCarubv10012936mCarubv10022617mCarubv10000235m
Chlamydomonas reinhardtiiCre06.g270100.t1.3Cre10.g444700.t1.1Cre06.g289850.t1.3Cre08.g373450.t1.1
Citrus clementinaCiclev10007401mCiclev10011063mCiclev10000406mCiclev10000374mCiclev10000272m
Ciclev10000256m
Citrus sinensisorange1.1g035501morange1.1g002609morange1.1g004765morange1.1g004253morange1.1g003474m
orange1.1g003390morange1.1g003230morange1.1g003226m
Cucumis sativusCucsa.378410.2Cucsa.378410.1Cucsa.077550.3Cucsa.077550.1Cucsa.077550.2
Eucalyptus grandisEucgr.F03487.1Eucgr.A01533.1Eucgr.F01770.1
Fragaria vescamrna30233.1-v1.0-hybridmrna08644.1-v1.0-hybridmrna08646.1-v1.0-hybrid
Glycine maxGlyma18g10385.1Glyma03g35020.2Glyma03g35020.1Glyma19g37750.2Glyma19g37750.1
Glyma04g01950.2
Gossypium raimondiiGorai.009G406400.4Gorai.011G196000.5Gorai.011G196000.4Gorai.011G196000.3Gorai.011G196000.2
Gorai.011G196000.12Gorai.011G196000.1Gorai.011G196000.7Gorai.011G196000.6Gorai.011G196000.13
Gorai.002G172100.7Gorai.002G172100.5Gorai.002G172100.3Gorai.002G172100.2Gorai.002G172100.1
Gorai.009G441800.2Gorai.009G441800.1Gorai.009G406400.6Gorai.009G406400.5Gorai.009G406400.3
Gorai.009G406400.2Gorai.009G406400.1Gorai.002G241400.7Gorai.002G241400.6Gorai.002G241400.5
Gorai.002G241400.4Gorai.002G241400.2Gorai.002G241400.1Gorai.005G113800.3Gorai.005G113800.2
Gorai.005G113800.1
Linum usitatissimumLus10000912Lus10023878Lus10014382Lus10016012Lus10012264
Malus domesticaMDP0000218396MDP0000148418MDP0000214735MDP0000177786
Manihot esculentacassava4.1_006199mcassava4.1_004366mcassava4.1_003773mcassava4.1_001701mcassava4.1_001686m
cassava4.1_002337mcassava4.1_002172mcassava4.1_002171mcassava4.1_001826mcassava4.1_001598m
cassava4.1_001595m
Medicago truncatulaMedtr7g104080.1
Mimulus guttatusmgv1a001162mmgv1a001301mmgv1a001932m
Oryza sativaLOC_Os02g32660.2LOC_Os06g26234.3LOC_Os06g26234.2LOC_Os06g26234.1LOC_Os02g32660.1
LOC_Os06g51084.8LOC_Os06g51084.7LOC_Os06g51084.6LOC_Os06g51084.5LOC_Os06g51084.4
LOC_Os06g51084.3LOC_Os06g51084.2LOC_Os06g51084.1
Panicum virgatumPavirv00035568mPavirv00058932mPavirv00002278mPavirv00067040mPavirv00061484m
Pavirv00061483mPavirv00061485m
Physcomitrella patensPp1s200_23V6.1Pp1s15_181V6.2Pp1s15_181V6.1Pp1s54_189V6.2Pp1s54_189V6.1
Pp1s64_78V6.1
Phaseolus vulgarisPhvul.006G047000.1Phvul.001G187600.1Phvul.009G011000.1
Picea abiesMA_10430611g0010
Populus trichocarpaPotri.006G115100.5Potri.001G359200.1Potri.006G115100.6Potri.006G115100.4Potri.006G115100.3
Potri.006G115100.2Potri.006G115100.1Potri.005G251000.5Potri.005G251000.4Potri.005G251000.3
Potri.005G251000.2Potri.005G251000.1Potri.005G251000.6
Prunus persicappa016544mppa001312mppa001929m
Ricinus communis29762.m00048630170.m01435927496.m000095
Setaria italicaSi008087mSi016350mSi009379mSi009312mSi005911m
Si006006mSi006081m
Selaginella moellendorffii165481437348437417
Sorghum bicolorSb03g027310.1Sb04g021540.1Sb06g015360.1Sb10g030776.1
Thellungiella halophilaThhalv10020019mThhalv10016249mThhalv10012785mThhalv10012784mThhalv10012679m
Vitis viniferaGSVIVT01037695001GSVIVT01033801001GSVIVT01008673001
Volvox carteriVocar20012173mVocar20015251mVocar20002436mVocar20007338m
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)