y PlantCAZyme

CAZyme Information

Basic Information
SpeciesBrachypodium distachyon
Cazyme IDBradi5g10700.1
FamilyCE8
Protein PropertiesLength: 466 Molecular Weight: 50256.4 Isoelectric Point: 8.9969
ChromosomeChromosome/Scaffold: 5 Start: 14029419 End: 14030816
DescriptionPlant invertase/pectin methylesterase inhibitor superfamily
View CDS
External Links
NCBI Taxonomy
Plaza
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
CE81654590
  PCDYSTVQAAVNAAPNNTYGHFVIAVAAGVYEENVIIPFEKTNILLVGEGMGATIITASRSVGIEGLGTYDTATVAVTGDGFRARDITFENSAGAGAHQA
  VTFRSDSDQSVLENVEFRGHQDTLYARTMRHFYRRCHITGTVDFIFGNAAAMFEECVIKTVPRAEGARKSARNVVAANGRIDPGQTTGFVFRNCSVDGNK
  EFMLLFQAKPQSYQLYLGRPWKEYSRTVYVSCYLGKVVMPEGWLPWRGDFALRSLYYGEFDSRGPGANYTSRVKWSSQTPDKHVGFYSVESFIQG
Full Sequence
Protein Sequence     Length: 466     Download
MPRTHHPHVL PRRRRLLPIA AAAAALVLLA LLILLPAAPP GAPASLLRAA IAAHPSAASY    60
AHPCADHLSL SLHRLRAALS ALESGDQPAA LHLASASLQC QYDCSHLLSL PAFPSQTLTS    120
RFLNSLTPQT LIASPKLSAA SAAAAFPAMV RPTATVCKPS PAAKPCDYST VQAAVNAAPN    180
NTYGHFVIAV AAGVYEENVI IPFEKTNILL VGEGMGATII TASRSVGIEG LGTYDTATVA    240
VTGDGFRARD ITFENSAGAG AHQAVTFRSD SDQSVLENVE FRGHQDTLYA RTMRHFYRRC    300
HITGTVDFIF GNAAAMFEEC VIKTVPRAEG ARKSARNVVA ANGRIDPGQT TGFVFRNCSV    360
DGNKEFMLLF QAKPQSYQLY LGRPWKEYSR TVYVSCYLGK VVMPEGWLPW RGDFALRSLY    420
YGEFDSRGPG ANYTSRVKWS SQTPDKHVGF YSVESFIQGH VWIAY*                   480
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
PLN02713PLN027139.0e-96167463306+
PLN02301PLN023011.0e-99167463300+
PLN02201PLN022019.0e-100167463304+
pfam01095Pectinesterase9.0e-131166459300+
PLN02708PLN027082.0e-156155463310+
Gene Ontology
GO TermDescription
GO:0005618cell wall
GO:0030599pectinesterase activity
GO:0042545cell wall modification
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
EMBLCAE02750.204346553480OSJNBa0006B20.19 [Oryza sativa (japonica cultivar-group)]
EMBLCAH67582.104346551478H0315A08.12 [Oryza sativa (indica cultivar-group)]
GenBankEAY94221.104346553480hypothetical protein OsI_15995 [Oryza sativa Indica Group]
RefSeqNP_001140854.1014651471hypothetical protein LOC100272930 [Zea mays]
RefSeqXP_002446513.1014651468hypothetical protein SORBIDRAFT_06g017280 [Sorghum bicolor]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB1xg2_A016746314304B Chain B, Crystal Structure Of The Complex Between Pectin Methylesterase And Its Inhibitor Protein
PDB1gq8_A016746318308A Chain A, Pectin Methylesterase From Carrot
PDB3uw0_A6e-1716732943224A Chain A, Pectin Methylesterase From Yersinia Enterocolitica
PDB2ntq_B0.0000000000000011543856245A Chain A, Pectin Methylesterase From Yersinia Enterocolitica
PDB2ntq_A0.0000000000000011543856245A Chain A, Pectin Methylesterase From Yersinia Enterocolitica
Metabolic Pathways
Pathway NameReactionECProtein Name
homogalacturonan degradationRXN-2102EC-3.1.1.11pectinesterase
Transmembrane Domains
StartEnd
1638
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
FL7604822542134660
EL6843472592054630
DT7451542761884630
EC8888532851794630
EC9561722632014630
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_1260_00001.1Aquca_022_00312.1
Arabidopsis lyrata919784325521
Arabidopsis thalianaAT5G09760.1AT5G64640.1
Brachypodium distachyonBradi2g56820.1
Brassica rapaBra024317Bra028619Bra037786Bra006031Bra009401
Bra028617Bra009400Bra002149
Carica papayaevm.model.supercontig_42.121
Capsella rubellaCarubv10026126mCarubv10000564m
Citrus clementinaCiclev10025271m
Citrus sinensisorange1.1g009085m
Cucumis sativusCucsa.249950.1
Eucalyptus grandisEucgr.H04944.1
Fragaria vescamrna26037.1-v1.0-hybridmrna17879.1-v1.0-hybrid
Glycine maxGlyma05g32380.1Glyma08g15650.1Glyma06g15711.1
Gossypium raimondiiGorai.011G116400.1Gorai.003G067900.1Gorai.007G064900.1
Linum usitatissimumLus10013721Lus10033486Lus10020888Lus10005587
Malus domesticaMDP0000196867MDP0000200773MDP0000233370MDP0000297071MDP0000174996
MDP0000204084MDP0000173284MDP0000174791
Manihot esculentacassava4.1_006847mcassava4.1_004527mcassava4.1_004459mcassava4.1_021091mcassava4.1_005773m
Medicago truncatulaMedtr8g093460.1Medtr3g095920.1
Mimulus guttatusmgv1a004027mmgv1a008938mmgv1a007669mmgv1a003977mmgv1a019250m
Oryza sativaLOC_Os01g65790.1LOC_Os04g35770.1
Panicum virgatumPavirv00054696mPavirv00008464mPavirv00032807mPavirv00008364m
Physcomitrella patensPp1s382_22V6.1Pp1s216_42V6.1Pp1s151_23V6.2Pp1s76_125V6.1Pp1s151_23V6.1
Phaseolus vulgarisPhvul.002G270900.1Phvul.009G148900.1
Picea abiesMA_10430460g0010.462.762MA_10427058g0010.383.512MA_10427058g0010.383.512MA_10427058g0010.79.248MA_10427058g0010.79.248
MA_906551g0010MA_2253g0010MA_54974g0010MA_68362g0010MA_10430460g0010.462.762
MA_67675g0010MA_495624g0010
Populus trichocarpaPotri.005G061500.1Potri.007G107300.2Potri.007G107300.3Potri.007G107300.1
Prunus persicappa021056mppa024386mppa003915m
Ricinus communis30136.m001028
Setaria italicaSi005458mSi010057m
Selaginella moellendorffii8374476314420760
Sorghum bicolorSb06g017280.1Sb03g041680.1
Thellungiella halophilaThhalv10013067mThhalv10003853m
Vitis viniferaGSVIVT01026518001
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)