y PlantCAZyme

CAZyme Information

Basic Information
SpeciesBrachypodium distachyon
Cazyme IDBradi5g10710.1
FamilyGT1
Protein PropertiesLength: 471 Molecular Weight: 49416.9 Isoelectric Point: 6.7479
ChromosomeChromosome/Scaffold: 5 Start: 14042335 End: 14043747
DescriptionUDP-glucosyl transferase 89B1
View CDS
External Links
NCBI Taxonomy
Plaza
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GT1464493.7e-33
  PGNAHLLSPLLAAHPSSIRPLTLPFPSHPSLPAGLENLKACPPIYAAVFVHALAALHHPILAWTKSQPHPVVAVLSDFFCGWTQPLAAELGVPRLVFAPS
  GVLGTAIPHSLFRRSVKPRPSNDAVGFPGIPGEPAYQWKELSIMYKMHAEGLVEARLGEAVKQNFLWNLESWGFVSNTFRALEGRYLDTPLEDLGSRRVW
  AVGPVAPETAVHRGGEAAVGAGELGAWLDAFPEGSVVYVCFGSQVVLTPPVAAALAEALERSAVPFVWAVGAGDEDGGDVVPEGFEAKAKRRGLVVRGWA
  PQVAALRHAAVGWFVTHCGWNSVLESVAAGVPMLAWPMTADQFANARLVVDEARVAVRACEGGVGVSPDAAELTAVLRNAAGGGEECRSVRARAKELAAE
  AAAA
Full Sequence
Protein Sequence     Length: 471     Download
MPSITAPSSP HVLVVPFPAQ GHTLALLDLA ALLAARGLRL TVVTTPGNAH LLSPLLAAHP    60
SSIRPLTLPF PSHPSLPAGL ENLKACPPIY AAVFVHALAA LHHPILAWTK SQPHPVVAVL    120
SDFFCGWTQP LAAELGVPRL VFAPSGVLGT AIPHSLFRRS VKPRPSNDAV GFPGIPGEPA    180
YQWKELSIMY KMHAEGLVEA RLGEAVKQNF LWNLESWGFV SNTFRALEGR YLDTPLEDLG    240
SRRVWAVGPV APETAVHRGG EAAVGAGELG AWLDAFPEGS VVYVCFGSQV VLTPPVAAAL    300
AEALERSAVP FVWAVGAGDE DGGDVVPEGF EAKAKRRGLV VRGWAPQVAA LRHAAVGWFV    360
THCGWNSVLE SVAAGVPMLA WPMTADQFAN ARLVVDEARV AVRACEGGVG VSPDAAELTA    420
VLRNAAGGGE ECRSVRARAK ELAAEAAAAV RGGGSSCQDL ESLVQEIRKL *             480
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
PLN03004PLN030046.0e-33116410306+
PLN00164PLN001641.0e-38115469386+
PLN03007PLN030074.0e-4011467489+
PLN02534PLN025341.0e-431470503+
PLN02863PLN028632.0e-1131470480+
Gene Ontology
GO TermDescription
GO:0008152metabolic process
GO:0016758transferase activity, transferring hexosyl groups
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankACF22719.1034709484UDP-glycosyltransferase [Brachypodium distachyon]
EMBLCAJ86181.10864703377H0212B02.10 [Oryza sativa (indica cultivar-group)]
GenBankEEC78140.10864703365hypothetical protein OsI_17697 [Oryza sativa Indica Group]
RefSeqNP_001054090.1084706469Os04g0650400 [Oryza sativa (japonica cultivar-group)]
RefSeqXP_002448651.1054706480hypothetical protein SORBIDRAFT_06g030820 [Sorghum bicolor]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB2pq6_A7.00005e-4164675477A Chain A, Crystal Structure Of Medicago Truncatula Ugt85h2- Insights Into The Structural Basis Of A Multifunctional (Iso) Flavonoid Glycosyltransferase
PDB2vg8_A5e-4084605460A Chain A, Crystal Structure Of Medicago Truncatula Ugt85h2- Insights Into The Structural Basis Of A Multifunctional (Iso) Flavonoid Glycosyltransferase
PDB2vch_A5e-4084605460A Chain A, Crystal Structure Of Medicago Truncatula Ugt85h2- Insights Into The Structural Basis Of A Multifunctional (Iso) Flavonoid Glycosyltransferase
PDB2vce_A5e-4084605460A Chain A, Characterization And Engineering Of The Bifunctional N- And O-glucosyltransferase Involved In Xenobiotic Metabolism In Plants
PDB2acv_B1e-3784678461A Chain A, Crystal Structure Of Medicago Truncatula Ugt71g1
Metabolic Pathways
Pathway NameReactionECProtein Name
cytokinins-O-glucoside biosynthesisRXN-4723EC-2.4.1.203trans-zeatin O-β-D-glucosyltransferase
cytokinins-O-glucoside biosynthesisRXN-4726EC-2.4.1UDP-glucose:dihydrozeatin O-β-D-glucosyltransferase
cytokinins-O-glucoside biosynthesisRXN-4735EC-2.4.1.215cis-zeatin O-β-D-glucosyltransferase
cytokinins-O-glucoside biosynthesisRXN-4737EC-2.4.1dihydrozeatin-9-N-glucoside O-β-D-glucosyltransferase
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
EG63125648794670
EC888987285102850
HX163206216412520
EE018658251102530
EE033998251102530
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_025_00233.1Aquca_006_00378.1Aquca_006_00376.1
Arabidopsis lyrata892083487125895254887793
Arabidopsis thalianaAT5G03490.1AT1G51210.1AT1G73880.1AT1G06000.1
Brachypodium distachyonBradi3g38930.1Bradi5g24280.1Bradi3g38937.1Bradi1g43600.1
Brassica rapaBra021887Bra014275Bra018901Bra003824
Carica papayaevm.model.supercontig_84.77evm.model.supercontig_3.220evm.model.supercontig_3.217
Capsella rubellaCarubv10012161mCarubv10023200mCarubv10019517m
Citrus clementinaCiclev10031430mCiclev10020006m
Citrus sinensisorange1.1g042753m
Cucumis sativusCucsa.149660.1
Eucalyptus grandisEucgr.B00651.1Eucgr.B00649.1Eucgr.B00652.1Eucgr.B00650.1Eucgr.B00655.1
Fragaria vescamrna04524.1-v1.0-hybridmrna04525.1-v1.0-hybridmrna26144.1-v1.0-hybrid
Glycine maxGlyma06g40390.1Glyma01g09160.1Glyma06g22820.1
Gossypium raimondiiGorai.012G185000.3Gorai.012G185000.2Gorai.012G185000.1Gorai.012G184900.1Gorai.008G174800.1
Gorai.012G185100.1Gorai.003G103500.1Gorai.006G228500.1Gorai.006G228600.1Gorai.006G228800.1
Linum usitatissimumLus10034650Lus10013500Lus10036840Lus10036837Lus10007972
Malus domesticaMDP0000452163MDP0000322436MDP0000221563MDP0000234849
Manihot esculentacassava4.1_034323mcassava4.1_006835mcassava4.1_006752mcassava4.1_028099m
Medicago truncatulaMedtr2g059240.1
Mimulus guttatusmgv1a019609mmgv1a008307m
Oryza sativaLOC_Os06g17260.1LOC_Os08g38160.1LOC_Os04g55680.1LOC_Os08g38130.1LOC_Os08g38110.1
LOC_Os06g17120.1LOC_Os06g17140.1LOC_Os06g17250.1LOC_Os06g17020.1LOC_Os06g17110.1
Panicum virgatumPavirv00056484mPavirv00050341mPavirv00051468mPavirv00041386mPavirv00036251m
Pavirv00055583mPavirv00021505mPavirv00001223mPavirv00015738mPavirv00056972m
Phaseolus vulgarisPhvul.003G036900.1Phvul.011G151100.1Phvul.011G151200.1
Picea abiesMA_11273g0020MA_10434954g0010MA_9790207g0010MA_265454g0010MA_57964g0010
MA_705145g0010
Populus trichocarpaPotri.010G137000.1Potri.012G065100.1
Prunus persicappa024271mppa018626m
Ricinus communis30138.m00391130138.m00390930138.m00389030138.m003910
Setaria italicaSi019365mSi015554mSi009974mSi013651mSi015553m
Sorghum bicolorSb07g028920.1Sb06g030880.1Sb10g010340.1Sb06g030820.1Sb10g010343.1
Thellungiella halophilaThhalv10012395mThhalv10018506m
Vitis viniferaGSVIVT01008168001
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)