y PlantCAZyme

CAZyme Information

Basic Information
SpeciesBrachypodium distachyon
Cazyme IDBradi5g12137.1
FamilyCBM43
Protein PropertiesLength: 474 Molecular Weight: 50862.1 Isoelectric Point: 8.5306
ChromosomeChromosome/Scaffold: 5 Start: 15613229 End: 15615123
DescriptionO-Glycosyl hydrolases family 17 protein
View CDS
External Links
NCBI Taxonomy
Plaza
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
CBM433824654e-22
  WCMTKKLANGTAVREQVAAACKDEAALCDPVRPGGRCHLPDTVAAHASYVFSAHWNRFSKQYGGWCYFAGLAVETTIDPSHGSC
GH17313540
  LGVSYGTLGDDLPPPHVALELARSAGAAAVRFYDSNATLLAAASSSGLGFVPGVPNELIPSLSASRRAADAWVASTLLPFRRNPRLRYLFVGNEVLSDPT
  TKSRWSQLVPAMANLHRALRRHGLGRVKVSTTLGMDALVGQNVFPPSAGVFRPDIVDVAVRPLLAFLERTESYLFVDTYTYFTWTANHTVVPLPYALLEA
  SKFRYHDPGTGLSYTNLLDHMLDAVVAAMCGAGHCGVKLALAETGWPNAGDLDQFGANVRNAATYNRNVARHLASGAGTPRRPGMMRMPAFVFALFNEDL
  KGGPGTERHWGLFYPNSSAVYEVD
Full Sequence
Protein Sequence     Length: 474     Download
MTMSPSIVVV ALNLLLFLAD AALATEPAHF LGVSYGTLGD DLPPPHVALE LARSAGAAAV    60
RFYDSNATLL AAASSSGLGF VPGVPNELIP SLSASRRAAD AWVASTLLPF RRNPRLRYLF    120
VGNEVLSDPT TKSRWSQLVP AMANLHRALR RHGLGRVKVS TTLGMDALVG QNVFPPSAGV    180
FRPDIVDVAV RPLLAFLERT ESYLFVDTYT YFTWTANHTV VPLPYALLEA SKFRYHDPGT    240
GLSYTNLLDH MLDAVVAAMC GAGHCGVKLA LAETGWPNAG DLDQFGANVR NAATYNRNVA    300
RHLASGAGTP RRPGMMRMPA FVFALFNEDL KGGPGTERHW GLFYPNSSAV YEVDLSGRRT    360
AASSYPPLPP ATNDAPYPGK LWCMTKKLAN GTAVREQVAA ACKDEAALCD PVRPGGRCHL    420
PDTVAAHASY VFSAHWNRFS KQYGGWCYFA GLAVETTIDP SHGSCRYPSV IPG*          480
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
COG5309COG53090.00225534697+
pfam07983X85.0e-638145479+
smart00768X88.0e-2438146787+
pfam00332Glyco_hydro_171.0e-7231354325+
Gene Ontology
GO TermDescription
GO:0004553hydrolase activity, hydrolyzing O-glycosyl compounds
GO:0005975carbohydrate metabolic process
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankEEC76519.10124728473hypothetical protein OsI_14305 [Oryza sativa Indica Group]
GenBankEEC84834.1094714476hypothetical protein OsI_31928 [Oryza sativa Indica Group]
RefSeqNP_001051879.10124728473Os03g0845600 [Oryza sativa (japonica cultivar-group)]
RefSeqNP_001063586.1094714479Os09g0502200 [Oryza sativa (japonica cultivar-group)]
RefSeqXP_002463526.10124715481hypothetical protein SORBIDRAFT_01g001430 [Sorghum bicolor]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB2cyg_A0313551312A Chain A, Crystal Structure At 1.45- Resolution Of The Major Allergen Endo-Beta-1,3-Glucanase Of Banana As A Molecular Basis For The Latex-Fruit Syndrome
PDB1ghr_A0313551306A Chain A, Crystal Structure At 1.45- Resolution Of The Major Allergen Endo-Beta-1,3-Glucanase Of Banana As A Molecular Basis For The Latex-Fruit Syndrome
PDB1aq0_B0313551306A Chain A, Barley 1,3-1,4-Beta-Glucanase In Monoclinic Space Group
PDB1aq0_A0313551306A Chain A, Barley 1,3-1,4-Beta-Glucanase In Monoclinic Space Group
PDB1ghs_B0313551306A Chain A, The Three-Dimensional Structures Of Two Plant Beta-Glucan Endohydrolases With Distinct Substrate Specificities
Transmembrane Domains
StartEnd
724
Signal Peptide
Cleavage Site
24
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
EC904594281993770
EE158298273993690
DT5722513061154180
EE043969263993590
DT7372832712044700
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_034_00089.1.396.481Aquca_009_00879.1.376.461
Arabidopsis lyrata317589.371.454479892.387.470493503.389.472
Arabidopsis thalianaAT3G07320.1.371.454AT3G23770.1.387.470AT4G14080.1.389.472
Brachypodium distachyonBradi3g40907.1.397.480Bradi3g40907.1.397.480Bradi4g34390.1.385.471Bradi5g12137.1.382.465Bradi3g40907.1.501.584
Bradi3g40907.1.501.584
Brassica rapaBra001918.391.473Bra028343.387.470Bra037057.390.473Bra014979.389.472Bra001245.371.450
Bra032758.391.474Bra029639.371.454Bra038969.390.468
Carica papayaevm.model.supercontig_8.110.373.456evm.model.supercontig_157.32.380.459
Capsella rubellaCarubv10006945m.389.472Carubv10015952m.387.470Carubv10013655m.371.454
Citrus clementinaCiclev10031440m.377.460Ciclev10004917m.379.458
Citrus sinensisorange1.1g012660m.379.457
Cucumis sativusCucsa.251950.1.378.460Cucsa.149990.1.374.457
Eucalyptus grandisEucgr.K02113.2.377.460Eucgr.K02113.1.377.460Eucgr.H02646.1.352.434
Fragaria vescamrna17437.1-v1.0-hybrid.483.561mrna17436.1-v1.0-hybrid.347.425
Glycine maxGlyma18g32840.1.378.461Glyma08g46110.1.378.461
Gossypium raimondiiGorai.005G026800.1.373.456Gorai.001G230200.2.372.451Gorai.006G224700.1.373.456Gorai.001G230200.3.297.380Gorai.001G230200.1.372.455
Gorai.N004800.1.375.458
Linum usitatissimumLus10008881.379.462Lus10023226.358.441Lus10001740Lus10025892.333.417Lus10038211.374.458
Malus domesticaMDP0000317729.374.452MDP0000283768.334.416MDP0000235663.374.452
Manihot esculentacassava4.1_023781m.375.458cassava4.1_024973m.361.439cassava4.1_007070m.376.459
Medicago truncatulaMedtr8g012400.1.374.457
Mimulus guttatusmgv1a005774m.382.465mgv1a006049m.370.453
Oryza sativaLOC_Os09g32550.2.384.471LOC_Os09g32550.1.387.474LOC_Os03g62860.1.382.467LOC_Os08g41410.1.385.467
Panicum virgatumPavirv00066351m.389.471Pavirv00044843m.360.447Pavirv00008164m.395.481Pavirv00006057m.374.460Pavirv00059046m.386.467
Phaseolus vulgarisPhvul.010G023800.1.372.455Phvul.008G142200.1.376.459
Picea abiesMA_907g0010MA_2025g0010.240.322MA_10426132g0010.130.212MA_10434158g0010.296.378MA_228746g0010.274.356
Populus trichocarpaPotri.002G247900.2.376.454Potri.002G247900.1.376.459Potri.002G247800.1.376.459Potri.017G060300.1.377.460Potri.001G321900.1.327.410
Prunus persicappa006984m.298.381ppa016789m.361.446
Ricinus communis28401.m000073.298.381
Setaria italicaSi029669m.389.476Si015679m.397.484
Selaginella moellendorffii85067.362.443
Sorghum bicolorSb01g001430.1.390.476Sb02g029080.1.388.475Sb07g026540.1.393.478
Thellungiella halophilaThhalv10002513m.385.468Thhalv10025081m.390.473Thhalv10020660m.380.463Thhalv10020663m.380.463
Vitis viniferaGSVIVT01031619001.286.369GSVIVT01031698001.378.461
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)