y PlantCAZyme

CAZyme Information

Basic Information
SpeciesBrachypodium distachyon
Cazyme IDBradi5g13460.1
FamilyGT17
Protein PropertiesLength: 390 Molecular Weight: 45484.3 Isoelectric Point: 7.9872
ChromosomeChromosome/Scaffold: 5 Start: 17011319 End: 17014092
Descriptionbeta-1,4-N-acetylglucosaminyltransferase family protein
View CDS
External Links
NCBI Taxonomy
Plaza
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GT17943810
  VTMENLCKLHGWKVRETPRRVVDAVLFSNELDILELRWNELSPYVSEFVLLESNSTFTGLTKPLHFKENRQRFEFAESRLTYGMVGGRFVKGENPFVEES
  YQRVYLDRLIKISRIKDDDILIMSDVDEIPSGHTINLLRWCDDTPEIIHLQLRNYLYSFEFLLDDKSWRASIHRYRSGKTRYAHFRQTDELLADSGWHCS
  FCFRHISDFAFKMQAYSHVDRIRFKYFLNPERIQDVICRGADLFDMLPEEYTFQEIIAKLGAIPSTYSAVHLPSFLLQNADRFRYLLP
Full Sequence
Protein Sequence     Length: 390     Download
MPEAGHYGHK KNDGICNGVC SSEPASKAVV AMSRLKCALR GFDFRVLLAL LIGVPIVILM    60
VYTHGQKVTY FLRPIWESPP KPFKIIPHYY HENVTMENLC KLHGWKVRET PRRVVDAVLF    120
SNELDILELR WNELSPYVSE FVLLESNSTF TGLTKPLHFK ENRQRFEFAE SRLTYGMVGG    180
RFVKGENPFV EESYQRVYLD RLIKISRIKD DDILIMSDVD EIPSGHTINL LRWCDDTPEI    240
IHLQLRNYLY SFEFLLDDKS WRASIHRYRS GKTRYAHFRQ TDELLADSGW HCSFCFRHIS    300
DFAFKMQAYS HVDRIRFKYF LNPERIQDVI CRGADLFDML PEEYTFQEII AKLGAIPSTY    360
SAVHLPSFLL QNADRFRYLL PGNCRRESG*                                     420
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
pfam04724Glyco_transf_17031388359+
Gene Ontology
GO TermDescription
GO:0003830beta-1,4-mannosylglycoprotein 4-beta-N-acetylglucosaminyltransferase activity
GO:0006487protein N-linked glycosylation
GO:0016020membrane
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankACN34312.1013891388unknown [Zea mays]
GenBankEEC73515.1013891389hypothetical protein OsI_07894 [Oryza sativa Indica Group]
RefSeqNP_001053087.1013891388Os04g0477500 [Oryza sativa (japonica cultivar-group)]
RefSeqNP_001148828.1013891388acetylglucosaminyltransferase/ transferase, transferring glycosyl groups [Zea mays]
RefSeqXP_002448043.1013891388hypothetical protein SORBIDRAFT_06g020110 [Sorghum bicolor]
Transmembrane Domains
StartEnd
4163
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
GT039550334483810
GO838876338373740
EH1938192871043900
GT037681301903900
GO86879229712960
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_054_00007.1Aquca_011_00497.1Aquca_004_00750.1
Arabidopsis lyrata484544477353488289888651894549
480301347008
Arabidopsis thalianaAT3G27540.1AT5G14480.1AT1G12990.1AT3G01620.1AT1G67880.1
AT2G13290.2AT2G13290.1AT3G26445.1
Brachypodium distachyonBradi3g47640.1Bradi5g13460.2Bradi4g01980.1
Brassica rapaBra025284Bra006256Bra019802Bra008753Bra023467
Bra016746Bra039107Bra004065Bra037205
Carica papayaevm.model.supercontig_796.1evm.model.supercontig_33.32evm.model.supercontig_46.29
Capsella rubellaCarubv10017415mCarubv10001154mCarubv10015252mCarubv10009381mCarubv10020435m
Carubv10014034m
Citrus clementinaCiclev10015571mCiclev10015565mCiclev10015564mCiclev10031761mCiclev10008737m
Citrus sinensisorange1.1g016270morange1.1g017399morange1.1g048655m
Cucumis sativusCucsa.011190.2Cucsa.011190.1Cucsa.286550.1Cucsa.292330.1
Eucalyptus grandisEucgr.J02255.2Eucgr.J02255.1Eucgr.H02492.1Eucgr.I01733.1Eucgr.J02258.2
Eucgr.J02258.1Eucgr.J02257.2Eucgr.J02257.1Eucgr.C01369.1
Fragaria vescamrna27942.1-v1.0-hybridmrna22181.1-v1.0-hybridmrna23231.1-v1.0-hybridmrna31095.1-v1.0-hybridmrna31094.1-v1.0-hybrid.474.584
mrna31094.1-v1.0-hybrid.474.584
Glycine maxGlyma11g37820.1Glyma19g00620.1Glyma18g01740.1Glyma19g08720.1Glyma08g14070.2
Glyma08g14070.1Glyma05g30870.3Glyma05g30870.2Glyma05g30870.1Glyma17g12100.4
Glyma17g12100.3Glyma17g12100.2Glyma13g22730.1
Gossypium raimondiiGorai.006G034700.2Gorai.006G034700.1Gorai.012G065000.5Gorai.012G065000.4Gorai.012G065000.3
Gorai.012G065000.2Gorai.012G065000.1Gorai.002G187800.1Gorai.008G161200.2Gorai.008G161200.1
Gorai.009G335700.2Gorai.009G335700.1Gorai.001G043800.2Gorai.001G043800.1
Linum usitatissimumLus10022281Lus10003666Lus10032088Lus10035231Lus10006475
Lus10006474Lus10038093Lus10043257Lus10019400
Malus domesticaMDP0000201653MDP0000152637MDP0000178334MDP0000835100MDP0000264603
MDP0000822876.173.371MDP0000822876.173.371MDP0000822876.111.169MDP0000822876.111.169
Manihot esculentacassava4.1_009467mcassava4.1_009463mcassava4.1_009272mcassava4.1_034314mcassava4.1_010308m
cassava4.1_010298m
Medicago truncatulaMedtr4g115070.1Medtr3g096150.1
Mimulus guttatusmgv1a007652mmgv1a007632mmgv1a008883mmgv1a019359mmgv1a008580m
Oryza sativaLOC_Os04g40150.2LOC_Os04g40150.1LOC_Os02g38140.2LOC_Os02g38140.1LOC_Os02g38160.2
LOC_Os02g38160.1LOC_Os12g41780.2LOC_Os12g41780.1
Panicum virgatumPavirv00051068mPavirv00039859mPavirv00069329mPavirv00051326mPavirv00028930m
Pavirv00025758m
Physcomitrella patensPp1s44_261V6.1Pp1s18_57V6.1
Phaseolus vulgarisPhvul.004G005100.1Phvul.001G254800.1Phvul.002G260100.1Phvul.003G167600.2Phvul.003G167600.1
Picea abiesMA_75537g0010MA_98254g0010MA_10435096g0010MA_8029g0010MA_110209g0010
MA_260011g0010MA_153610g0010MA_9836437g0010MA_10429458g0010MA_10244876g0010
MA_9697768g0010MA_10213817g0010MA_110372g0020
Populus trichocarpaPotri.001G343600.4Potri.001G343600.3Potri.001G343600.2Potri.001G343600.1Potri.010G046900.1
Potri.008G186000.1Potri.018G127900.3Potri.018G127900.2Potri.018G127900.1Potri.006G066700.2
Potri.006G066700.1
Prunus persicappa006973mppa006880mppa007558m
Ricinus communis29917.m00201829792.m00060329927.m000602
Setaria italicaSi010313mSi022434mSi019503m
Selaginella moellendorffii109556403018409063
Sorghum bicolorSb06g020110.1Sb04g024790.1Sb08g021190.1
Thellungiella halophilaThhalv10004592mThhalv10004374mThhalv10004372mThhalv10020899mThhalv10013782m
Thhalv10007850mThhalv10018686mThhalv10022755mThhalv10022754m
Vitis viniferaGSVIVT01032386001GSVIVT01000535001
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)