y PlantCAZyme

CAZyme Information

Basic Information
SpeciesBrachypodium distachyon
Cazyme IDBradi5g13560.1
FamilyGH5
Protein PropertiesLength: 563 Molecular Weight: 61544.1 Isoelectric Point: 8.3336
ChromosomeChromosome/Scaffold: 5 Start: 17087895 End: 17090341
DescriptionCellulase (glycosyl hydrolase family 5) protein
View CDS
External Links
NCBI Taxonomy
Plaza
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GH5393513.39955e-42
  IVDEAGDRVKLACVNWPSHLEPMLAEGLSKRPVGSIAGDVAAMGFNCVRLTWPTFMVTNASYTSLTVAQSFQRLNLTEPLAGIRANNPALVDLRLIDAFK
  AVVSSLGENNLMVILDNHVSMPKWCCSNTDGNGFFGDAYFQPDVWVDGLTKMATTFAAVPNVVGMSLRNELRGPRQNANDWYKYMQRGAEAVHAANPRAL
  VILSGLSYDNDLAFLSSRQVTLSFARKAAFEVHWYSFSNSQDWASSNPNEACARIGASVSRRALYLLDQGWPVFLSEFGVDNRGGNANDNRYYGCAAAVA
  ADLDLDWALWTLQ
Full Sequence
Protein Sequence     Length: 563     Download
MRFTSSVFTA WLALGLACHC ALLLRHAEAV TLSTASRWIV DEAGDRVKLA CVNWPSHLEP    60
MLAEGLSKRP VGSIAGDVAA MGFNCVRLTW PTFMVTNASY TSLTVAQSFQ RLNLTEPLAG    120
IRANNPALVD LRLIDAFKAV VSSLGENNLM VILDNHVSMP KWCCSNTDGN GFFGDAYFQP    180
DVWVDGLTKM ATTFAAVPNV VGMSLRNELR GPRQNANDWY KYMQRGAEAV HAANPRALVI    240
LSGLSYDNDL AFLSSRQVTL SFARKAAFEV HWYSFSNSQD WASSNPNEAC ARIGASVSRR    300
ALYLLDQGWP VFLSEFGVDN RGGNANDNRY YGCAAAVAAD LDLDWALWTL QGSYYLREGV    360
RDLDEVYGVL DRSWRNPRNA TALRRVRALQ RAFRGPGFAE AAPYVALFHP STGLCVARRS    420
SPVSPLELGS CEGAEAWAYD AQRQRLALRD SPLMCLRAEG AGRPVRVGMA CATDEMARWR    480
LVSDSKLHVA ANASSGAGML CLDVGADGRS VVTNTCRCLS ADNSCDPESQ WFKLVSSTRR    540
VGARSMLAQP PLKLKDLKIR SL*                                            600
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
COG2730BglC0.00546327319+
pfam00150Cellulase2.0e-1678327259+
Gene Ontology
GO TermDescription
GO:0004553hydrolase activity, hydrolyzing O-glycosyl compounds
GO:0005975carbohydrate metabolic process
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
EMBLCAD41090.203756236555OSJNBb0011N17.7 [Oryza sativa (japonica cultivar-group)]
EMBLCAH67677.103756236555H0510A06.2 [Oryza sativa (indica cultivar-group)]
GenBankEEC77495.103756236571hypothetical protein OsI_16343 [Oryza sativa Indica Group]
GenBankEEE61202.103756236571hypothetical protein OsJ_15212 [Oryza sativa Japonica Group]
RefSeqNP_001130915.102956233576hypothetical protein LOC100192019 [Zea mays]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB1vrx_B0.000000002343188285A Chain A, Endocellulase E1 From Acidothermus Cellulolyticus Mutant Y245g
PDB1vrx_A0.000000002343188285A Chain A, Endocellulase E1 From Acidothermus Cellulolyticus Mutant Y245g
PDB1ece_B0.000000003343188285A Chain A, Acidothermus Cellulolyticus Endocellulase E1 Catalytic Domain In Complex With A Cellotetraose
PDB1ece_A0.000000003343188285A Chain A, Acidothermus Cellulolyticus Endocellulase E1 Catalytic Domain In Complex With A Cellotetraose
PDB3qhm_C0.000064724861258A Chain A, Crystal Analysis Of The Complex Structure, E342a-Cellotetraose, Of Endocellulase From Pyrococcus Horikoshii
Signal Peptide
Cleavage Site
29
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
DV528309263312930
DT644828288313170
EE175974253312830
DV027509255312850
EC902529245312750
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_011_00429.2Aquca_011_00429.1Aquca_001_00170.1Aquca_001_00171.1Aquca_011_00425.1
Aquca_011_00424.1Aquca_011_00428.1Aquca_011_00423.1Aquca_001_00172.1
Arabidopsis lyrata471466322756864961488616326109
882032
Arabidopsis thalianaAT5G17500.1AT1G13130.1AT3G26140.1AT3G26130.1AT5G16700.1
Brachypodium distachyonBradi5g13550.1
Brassica rapaBra025186Bra019811Bra025187Bra026437Bra026436
Bra023580Bra013972Bra008603Bra026925
Carica papayaevm.model.supercontig_33.65evm.model.supercontig_33.69evm.model.supercontig_33.67
Capsella rubellaCarubv10008758mCarubv10019167mCarubv10016955mCarubv10002868m
Citrus clementinaCiclev10031098mCiclev10023534m
Citrus sinensisorange1.1g013842morange1.1g008330morange1.1g015062morange1.1g039248m
Cucumis sativusCucsa.286780.1Cucsa.275330.1Cucsa.115540.1Cucsa.108400.1Cucsa.115550.1
Cucsa.365480.1Cucsa.303610.1Cucsa.303620.1Cucsa.129000.1Cucsa.275320.1
Eucalyptus grandisEucgr.B03243.1Eucgr.H02462.1Eucgr.H02464.1Eucgr.H02457.1Eucgr.H02458.1
Eucgr.D01800.1
Glycine maxGlyma05g30691.1Glyma11g18350.1Glyma05g30681.1Glyma08g13880.2Glyma18g01630.1
Glyma08g13891.1Glyma08g06511.1Glyma07g08060.2
Gossypium raimondiiGorai.002G188600.1Gorai.012G173600.1
Linum usitatissimumLus10011404Lus10006462Lus10011403Lus10006461Lus10024686
Lus10032312
Malus domesticaMDP0000753366MDP0000729817
Manihot esculentacassava4.1_004696mcassava4.1_031675mcassava4.1_025125m
Medicago truncatulaMedtr4g091610.1Medtr7g012780.1Medtr7g012530.1Medtr3g086450.1Medtr7g012540.1
Medtr7g012840.1Medtr5g088330.1
Mimulus guttatusmgv1a004205mmgv1a018920mmgv1a020519mmgv1a004243mmgv1a004297m
Oryza sativaLOC_Os04g40510.2LOC_Os04g40510.1LOC_Os02g38260.1LOC_Os04g40500.1LOC_Os04g40490.1
Panicum virgatumPavirv00025159mPavirv00029795mPavirv00010845mPavirv00023661mPavirv00002791m
Pavirv00002936m
Physcomitrella patensPp1s94_121V6.1Pp1s114_176V6.1Pp1s298_71V6.1
Phaseolus vulgarisPhvul.002G258500.1Phvul.011G098000.1Phvul.002G258400.1Phvul.002G220300.1Phvul.010G095100.1
Picea abiesMA_318998g0010MA_463555g0010MA_8507901g0010MA_10432675g0010
Populus trichocarpaPotri.008G183400.2Potri.008G183400.1Potri.010G049700.1Potri.010G049800.1Potri.008G183400.3
Potri.001G097900.1Potri.T144300.1
Prunus persicappa003807m
Ricinus communis29929.m00479230190.m01129330190.m01129230190.m011291
Setaria italicaSi019475mSi009742mSi009751mSi009695m
Sorghum bicolorSb06g020270.1Sb06g020260.1Sb04g024910.1
Thellungiella halophilaThhalv10007253mThhalv10003934mThhalv10004045mThhalv10003968mThhalv10015581m
Thhalv10015466m
Vitis viniferaGSVIVT01000573001GSVIVT01019434001.470.783GSVIVT01019434001.470.783GSVIVT01019434001.35.351GSVIVT01019434001.35.351
GSVIVT01019433001GSVIVT01019436001GSVIVT01014359001GSVIVT01014358001GSVIVT01014355001
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)